(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE203

CP002209.PE203       Location/Qualifiers
FT   CDS             complement(223243..224196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0203"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847: IPR005119; KEGG: vfm:VFMJ11_2114 transcriptional
FT                   regulator; PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; SPTR: A3UYP2 Transcriptional regulators,
FT                   LysR family; PFAM: Bacterial regulatory helix-turn-helix
FT                   protein, lysR family; LysR substrate binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74417"
FT                   /db_xref="GOA:E1SL23"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL23"
FT                   /protein_id="ADN74417.1"
FT                   /translation="MAKDRFNNLDLNLLRTFVVLAQEGNMRRAAARLHVTQPAVSHALQ
FT                   RLRHHFEDELFIKVPGGMTPTQFARTLQERLKPVLVGLAEAVNDNNAFNPAELDTTLRI
FT                   ALPPHLNHYIGATLYRRLNRDAPNASVELMEWGGHTPVLLLNGELDVGVNIPFPHRSKE
FT                   LIAAPVGQDSGVMMVHHDHPYKGRSITPEQLSRWGLACLFNPGITDQQPIIQRVLEAHG
FT                   HSAKIRFRSASLPTIFSVLRQHDYFFPHTAALADSHAPEFRPVQLEVAPHYLTVDMFAY
FT                   YHRGHQHPAVTLWLVEHLAEALRGYLKPLLLSDKWD"
     MAKDRFNNLD LNLLRTFVVL AQEGNMRRAA ARLHVTQPAV SHALQRLRHH FEDELFIKVP        60
     GGMTPTQFAR TLQERLKPVL VGLAEAVNDN NAFNPAELDT TLRIALPPHL NHYIGATLYR       120
     RLNRDAPNAS VELMEWGGHT PVLLLNGELD VGVNIPFPHR SKELIAAPVG QDSGVMMVHH       180
     DHPYKGRSIT PEQLSRWGLA CLFNPGITDQ QPIIQRVLEA HGHSAKIRFR SASLPTIFSV       240
     LRQHDYFFPH TAALADSHAP EFRPVQLEVA PHYLTVDMFA YYHRGHQHPA VTLWLVEHLA       300
     EALRGYLKPL LLSDKWD                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page