(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE204

CP002209.PE204       Location/Qualifiers
FT   CDS             224505..225248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74418"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL24"
FT                   /protein_id="ADN74418.1"
FT                   /translation="MKPIAAVLTLLAPAAMATPLPYTFEAGQAAKANEVNANFSILAQA
FT                   QAGTDEQLSMVSAEVSDLQSALATLQEQVDALLPDFESRFCTSVETGSELVFSGVPFVS
FT                   SAFTLMDADGTTRRLNLMVPKAPMVTPQYQAALTGSDVAGYSKAFYFCDQPARLENVLK
FT                   VDYDLSDINEVAAYFYTETRLTVRHPAHDSEWFSNATRLELGKVALPRDGSGDYQLAPQ
FT                   DLPSVEAIKASLLGGYQVYFHSSLR"
     MKPIAAVLTL LAPAAMATPL PYTFEAGQAA KANEVNANFS ILAQAQAGTD EQLSMVSAEV        60
     SDLQSALATL QEQVDALLPD FESRFCTSVE TGSELVFSGV PFVSSAFTLM DADGTTRRLN       120
     LMVPKAPMVT PQYQAALTGS DVAGYSKAFY FCDQPARLEN VLKVDYDLSD INEVAAYFYT       180
     ETRLTVRHPA HDSEWFSNAT RLELGKVALP RDGSGDYQLA PQDLPSVEAI KASLLGGYQV       240
     YFHSSLR                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page