(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE205

CP002209.PE205       Location/Qualifiers
FT   CDS             225258..225425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74419"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL25"
FT                   /protein_id="ADN74419.1"
FT                   /translation="MKPLWIAAVALMLAACGSDHSDSENGHTPTQPIEPPGTDVVLIWD
FT                   DGQWDNSDWQ"
     MKPLWIAAVA LMLAACGSDH SDSENGHTPT QPIEPPGTDV VLIWDDGQWD NSDWQ             55
//

If you have problems or comments...

PBIL Back to PBIL home page