(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE206

CP002209.PE206       Location/Qualifiers
FT   CDS             complement(225475..227802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0206"
FT                   /product="Tex-like protein"
FT                   /note="COGs: COG2183 Transcriptional accessory protein;
FT                   InterPro IPR003029: IPR018974: IPR006641; KEGG:
FT                   ecf:ECH74115_4713 putative transcriptional accessory
FT                   protein; PFAM: Tex-like protein-like; RNA binding S1 domain
FT                   protein; SMART: Resolvase RNase H domain protein fold;
FT                   SPTR: A2P4I2 Putative uncharacterized protein; PFAM:
FT                   Tex-like protein N-terminal domain; S1 RNA binding domain;
FT                   TIGRFAM: glutamate--cysteine ligase/gamma-glutamylcysteine
FT                   synthetase, Streptococcus agalactiae type; competence
FT                   protein ComEA helix-hairpin-helix repeat region"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74420"
FT                   /db_xref="GOA:E1SL26"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL26"
FT                   /protein_id="ADN74420.1"
FT                   /translation="MEPISHLIAQELGVRPQQVQAAITLLDDGATVPFIARYRKEVTGT
FT                   LDDTQLRTLETRLGYLRELSDRRQSILKSIDEQGKLSDSLRAAIEAADTKTALEDLYLP
FT                   YKPKRRTKGQIAIEAGLLPLADSLFENPSQDPEQSASAYLNAEAGFDTTKAVLDGARAI
FT                   LMERFAEDATLLAKIRQHLQQNAHLKSQVISGQESNGAKFQDYFDHAEPWAKVPSHRTL
FT                   AMLRGRNEGVLALSLEADPNKEEGDRSSYCEQIIAQHFAIPTGNQPGERWLQQLCQWTW
FT                   RVKISLAMETELLGDLRERAEADAIKVFAENLSDLLMAAPAGMRPTLALDPGLRTGCKV
FT                   AVVDGTGKLVATDTIYPHAPQKRWNDALTVLAKLVNQHQVELIAVGNGTASRETDKLAG
FT                   ELIKALKKPGLTKVMVSEAGASVYSASETAALEFPTLDVALRGAVSIGRRLQDPLAELV
FT                   KIEPKSIGVGQYQHDVSQTQLARSLDAVVEDCVNGVGVDLNTASVPLLTRVAGLSRTLA
FT                   QNIVQFRDEHGRFTNRKQLLKVARLGPKAYEQCAGFLRIAGGDNPLDGSGVHPEAYPVV
FT                   KKISAHTGVAVAELVGNSGVLQSLRAGDFTDERFGLPTVNDILKELDKPGRDPRGQFET
FT                   AAFAEGVEKVSDLEPGMVLEGVVTNVANFGAFVDIGVHQDGLVHISALSNKFVEDPRTV
FT                   VKAGDVVKVKVMEVDVPRQRIGLSMRLDDQPGEARSQRSGGQDRPTRQPRKESRPARQS
FT                   DPAGGGLSGAFADAFANAKKRR"
     MEPISHLIAQ ELGVRPQQVQ AAITLLDDGA TVPFIARYRK EVTGTLDDTQ LRTLETRLGY        60
     LRELSDRRQS ILKSIDEQGK LSDSLRAAIE AADTKTALED LYLPYKPKRR TKGQIAIEAG       120
     LLPLADSLFE NPSQDPEQSA SAYLNAEAGF DTTKAVLDGA RAILMERFAE DATLLAKIRQ       180
     HLQQNAHLKS QVISGQESNG AKFQDYFDHA EPWAKVPSHR TLAMLRGRNE GVLALSLEAD       240
     PNKEEGDRSS YCEQIIAQHF AIPTGNQPGE RWLQQLCQWT WRVKISLAME TELLGDLRER       300
     AEADAIKVFA ENLSDLLMAA PAGMRPTLAL DPGLRTGCKV AVVDGTGKLV ATDTIYPHAP       360
     QKRWNDALTV LAKLVNQHQV ELIAVGNGTA SRETDKLAGE LIKALKKPGL TKVMVSEAGA       420
     SVYSASETAA LEFPTLDVAL RGAVSIGRRL QDPLAELVKI EPKSIGVGQY QHDVSQTQLA       480
     RSLDAVVEDC VNGVGVDLNT ASVPLLTRVA GLSRTLAQNI VQFRDEHGRF TNRKQLLKVA       540
     RLGPKAYEQC AGFLRIAGGD NPLDGSGVHP EAYPVVKKIS AHTGVAVAEL VGNSGVLQSL       600
     RAGDFTDERF GLPTVNDILK ELDKPGRDPR GQFETAAFAE GVEKVSDLEP GMVLEGVVTN       660
     VANFGAFVDI GVHQDGLVHI SALSNKFVED PRTVVKAGDV VKVKVMEVDV PRQRIGLSMR       720
     LDDQPGEARS QRSGGQDRPT RQPRKESRPA RQSDPAGGGL SGAFADAFAN AKKRR            775
//

If you have problems or comments...

PBIL Back to PBIL home page