(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE211

CP002209.PE211       Location/Qualifiers
FT   CDS             complement(232214..233074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0211"
FT                   /product="Hsp33 protein"
FT                   /note="COGs: COG1281 Disulfide bond chaperones of the HSP33
FT                   family; InterPro IPR000397; KEGG: swd:Swoo_4737 HSP33-like
FT                   chaperonin; PFAM: Hsp33 protein; SPTR: B1KN30 33 kDa
FT                   chaperonin; PFAM: Hsp33 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74425"
FT                   /db_xref="GOA:E1SL31"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL31"
FT                   /protein_id="ADN74425.1"
FT                   /translation="MTDKLYRYLFDQADVRGELVQLNDTYQQMLSGHDYPAPVQRLLGE
FT                   MVAATSLLTAILKFEGEIAVQIQGEGPLRLLVVNGTHTQALRGVARFDGEVVEGDLQQM
FT                   VGKGHLVITITPKEGERYQGVVGLTEPTLAGCLEQYFAQSEQLRTRLWLHANGEKAAGM
FT                   LLQEMPASNVDADVEFEHLESLTDTIKAEELFGLDPEEVLHRLYHQESVQVFEPSDVEF
FT                   RCTCSRERSLAALATIDRAELDSIVEEQGEIAMHCDYCGAHYRFDAVDIGALGQGSGDV
FT                   SSTQH"
     MTDKLYRYLF DQADVRGELV QLNDTYQQML SGHDYPAPVQ RLLGEMVAAT SLLTAILKFE        60
     GEIAVQIQGE GPLRLLVVNG THTQALRGVA RFDGEVVEGD LQQMVGKGHL VITITPKEGE       120
     RYQGVVGLTE PTLAGCLEQY FAQSEQLRTR LWLHANGEKA AGMLLQEMPA SNVDADVEFE       180
     HLESLTDTIK AEELFGLDPE EVLHRLYHQE SVQVFEPSDV EFRCTCSRER SLAALATIDR       240
     AELDSIVEEQ GEIAMHCDYC GAHYRFDAVD IGALGQGSGD VSSTQH                      286
//

If you have problems or comments...

PBIL Back to PBIL home page