(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE213

CP002209.PE213       Location/Qualifiers
FT   CDS             233698..234627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0213"
FT                   /product="general secretion pathway protein C"
FT                   /note="COGs: COG3031 Type II secretory pathway component
FT                   PulC; InterPro IPR001639; KEGG: slo:Shew_3620 general
FT                   secretion pathway protein C; SPTR: A2V2N5 General secretion
FT                   pathway protein C; TIGRFAM: general secretion pathway
FT                   protein C; TIGRFAM: general secretion pathway protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74427"
FT                   /db_xref="GOA:E1SL33"
FT                   /db_xref="InterPro:IPR001639"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL33"
FT                   /protein_id="ADN74427.1"
FT                   /translation="MDYSIAIQRLLAKVPQAALAKALTLGLALYALYLAALITWQLVPV
FT                   PEQTGPAWRPTAVTSSGGGESASLDGLLGLSLFGTPDKDPSANQPAQPVQRDLITDAPK
FT                   TTLRILLTGLVASSVEERGIAIIESGGSQETYGIGDKIKGTNASLHEVYADRAIILNQG
FT                   RYETLMLDGVEYTREMTSETQRLRETPQAEVDMRDDAETTQALEEAREAMLEDPGKLQD
FT                   YLAISPVKDRESGELRGYRLNPGKNRELFMQSGLQPNDLAVSMNGYDLTNMGESMQILS
FT                   QLADLEEVSLMVEREGQLTEVLFALPSQ"
     MDYSIAIQRL LAKVPQAALA KALTLGLALY ALYLAALITW QLVPVPEQTG PAWRPTAVTS        60
     SGGGESASLD GLLGLSLFGT PDKDPSANQP AQPVQRDLIT DAPKTTLRIL LTGLVASSVE       120
     ERGIAIIESG GSQETYGIGD KIKGTNASLH EVYADRAIIL NQGRYETLML DGVEYTREMT       180
     SETQRLRETP QAEVDMRDDA ETTQALEEAR EAMLEDPGKL QDYLAISPVK DRESGELRGY       240
     RLNPGKNREL FMQSGLQPND LAVSMNGYDL TNMGESMQIL SQLADLEEVS LMVEREGQLT       300
     EVLFALPSQ                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page