(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE222

CP002209.PE222       Location/Qualifiers
FT   CDS             242753..243943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0222"
FT                   /product="general secretion pathway protein L"
FT                   /note="COGs: COG3297 Type II secretory pathway component
FT                   PulL; InterPro IPR007812; KEGG: saz:Sama_0177 general
FT                   secretion pathway protein L; PFAM: General secretion
FT                   pathway L; SPTR: A2V2P4 General secretion pathway protein
FT                   L; TIGRFAM: general secretion pathway protein L; PFAM:
FT                   General secretion pathway protein L (GspL); TIGRFAM:
FT                   general secretion pathway protein L"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74436"
FT                   /db_xref="GOA:E1SLN7"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLN7"
FT                   /protein_id="ADN74436.1"
FT                   /translation="MSERLVIRLGSQAQQPIPWITWSEEQQTVISSGVLAGADGLASLS
FT                   ERAGGRPVEVLVDSSALTLTDVNLPAKAQRQAMKALPFMLEDELSEDVDKLHFVPGPRH
FT                   GDQLSVMVVAHAQLQLWLGWLAEAGLPVKKIVPDVLALARVEDTELSLMQLEQQLLVRT
FT                   GEGSGMVLDADWLPMMAESLQGEGRPWALFTPVALPEGIEAAEQPLELPMQALAQGFVR
FT                   TPANLLTGPYAPAKELSKLVSTWTKVGVAAAILLALVLVHRGVSWYQLEQERTALRAEG
FT                   ERIYRQLFPQEQRVPNPRGQLEAKVRALGGAGAGGQLLPMMAGLENAFAELPELRPTSI
FT                   RFDGNRSEIRLQLVGKDFAQFERFKELASGRFDVESGAINNDADGVSGIMTLRAKG"
     MSERLVIRLG SQAQQPIPWI TWSEEQQTVI SSGVLAGADG LASLSERAGG RPVEVLVDSS        60
     ALTLTDVNLP AKAQRQAMKA LPFMLEDELS EDVDKLHFVP GPRHGDQLSV MVVAHAQLQL       120
     WLGWLAEAGL PVKKIVPDVL ALARVEDTEL SLMQLEQQLL VRTGEGSGMV LDADWLPMMA       180
     ESLQGEGRPW ALFTPVALPE GIEAAEQPLE LPMQALAQGF VRTPANLLTG PYAPAKELSK       240
     LVSTWTKVGV AAAILLALVL VHRGVSWYQL EQERTALRAE GERIYRQLFP QEQRVPNPRG       300
     QLEAKVRALG GAGAGGQLLP MMAGLENAFA ELPELRPTSI RFDGNRSEIR LQLVGKDFAQ       360
     FERFKELASG RFDVESGAIN NDADGVSGIM TLRAKG                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page