(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE226

CP002209.PE226       Location/Qualifiers
FT   CDS             245788..246621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0226"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /note="COGs: COG1218 3'-Phosphoadenosine 5'-phosphosulfate
FT                   (PAPS) 3'-phosphatase; InterPro IPR000760: IPR006240; KEGG:
FT                   ppr:PBPRA3469 putative CysQ protein; PFAM: inositol
FT                   monophosphatase; SPTR: A3EJE2 CysQ protein; TIGRFAM:
FT                   3'(2'),5'-bisphosphate nucleotidase; PFAM: Inositol
FT                   monophosphatase family; TIGRFAM: 3'(2'),5'-bisphosphate
FT                   nucleotidase, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74440"
FT                   /db_xref="GOA:E1SLP1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP1"
FT                   /protein_id="ADN74440.1"
FT                   /translation="MVTPLHTLLEPVITIARDAGQQIRTIYEAGQYQSLTKSDNTPVTS
FT                   ADLAAHEWIVTALRTLTPDTPILSEEDADIPLSTRQHWNEYWLIDPLDGTQEFIAGSGE
FT                   FAVNIALVRDHQPVLGVIYAPMSEVWYYACQGHGAYKRHGDQTEAIHSRDVGPGDALKI
FT                   AVSRRQRREAVMSRLDEQREYLLLPFGSASLKSCMVAEGTADCYLRLGPTGEWDTGASQ
FT                   CIVEEAGGRIVDTCYQPLSYNERESLENPNYMVLGCQSLPWQEILPPGPECYSAE"
     MVTPLHTLLE PVITIARDAG QQIRTIYEAG QYQSLTKSDN TPVTSADLAA HEWIVTALRT        60
     LTPDTPILSE EDADIPLSTR QHWNEYWLID PLDGTQEFIA GSGEFAVNIA LVRDHQPVLG       120
     VIYAPMSEVW YYACQGHGAY KRHGDQTEAI HSRDVGPGDA LKIAVSRRQR REAVMSRLDE       180
     QREYLLLPFG SASLKSCMVA EGTADCYLRL GPTGEWDTGA SQCIVEEAGG RIVDTCYQPL       240
     SYNERESLEN PNYMVLGCQS LPWQEILPPG PECYSAE                                277
//

If you have problems or comments...

PBIL Back to PBIL home page