(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE227

CP002209.PE227       Location/Qualifiers
FT   CDS             complement(246656..247756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0227"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /EC_number="2.9.1.-"
FT                   /note="COGs: COG2603 ATPase; InterPro IPR001763: IPR017582;
FT                   KEGG: sfr:Sfri_0119 tRNA 2-selenouridine synthase; SMART:
FT                   Rhodanese domain protein; SPTR: Q089T3 tRNA 2-selenouridine
FT                   synthase; TIGRFAM: tRNA 2-selenouridine synthase; PFAM:
FT                   Rhodanese-like domain; TIGRFAM: tRNA 2-selenouridine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74441"
FT                   /db_xref="GOA:E1SLP2"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP2"
FT                   /protein_id="ADN74441.1"
FT                   /translation="MSEMIPQSEYRRLLLDDVPMIDLRAPVEFAKGAFPGSVNCPLMTD
FT                   SEREAVGTRYKEQGQNAAIALGHQLVNGAVKQSRVDAWVSQVTARPDTVLYCFRGGLRS
FT                   QLSQGWLAEAGYQRPYIEGGYKGMRGFLINQTDKVAEQADLLILGGMTGCGKTDFLNER
FT                   RDSVDLEGLANHRGSSFGRRIGGQPSQIDFENRLAIELMRHQDAGHRQLLLEDESRLIG
FT                   RESIPLTLFDAMTQAPRVMLEVSNEARIAQITKDYVTTMANDYLAQDAEQGFAEFENYL
FT                   LGSLDRIRRRLGGALHQDLRQRMTDALAEQARSGNVDGHSGWISLMLSHYYDPMYRYQL
FT                   EKMTAPVLFQGSPEAVHQFLNERGAR"
     MSEMIPQSEY RRLLLDDVPM IDLRAPVEFA KGAFPGSVNC PLMTDSEREA VGTRYKEQGQ        60
     NAAIALGHQL VNGAVKQSRV DAWVSQVTAR PDTVLYCFRG GLRSQLSQGW LAEAGYQRPY       120
     IEGGYKGMRG FLINQTDKVA EQADLLILGG MTGCGKTDFL NERRDSVDLE GLANHRGSSF       180
     GRRIGGQPSQ IDFENRLAIE LMRHQDAGHR QLLLEDESRL IGRESIPLTL FDAMTQAPRV       240
     MLEVSNEARI AQITKDYVTT MANDYLAQDA EQGFAEFENY LLGSLDRIRR RLGGALHQDL       300
     RQRMTDALAE QARSGNVDGH SGWISLMLSH YYDPMYRYQL EKMTAPVLFQ GSPEAVHQFL       360
     NERGAR                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page