(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE229

CP002209.PE229       Location/Qualifiers
FT   CDS             248964..250283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0229"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aha:AHA_3284 succinyl-CoA synthetase, alpha
FT                   subunit; SPTR: A3WP26 Uncharacterized conserved secreted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74443"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP4"
FT                   /protein_id="ADN74443.1"
FT                   /translation="MQFKTLGLALCALLLSACSDSSSTKNFTGTLRFATFHVDMAYDDS
FT                   QGYFTLLQQTGATGDQQDPRLANLAAILQQTYQERQPDVLLLTGFSTSVGEGGRADDTA
FT                   AVQFEQNYLSQPQASDLTGLSYPYRYVASTNSGQFIPYDIDGDGKLSLPEDAQGPGHFH
FT                   GQNSFVLLSKYALDAEQARTFRQFKWQDVNGVSKPKRDDGTELDDDAWAALSVMDTNFV
FT                   DIAMRLPDGRQISLLLTQLVDQQPAEGALRSGWAQQRNGAQLDFIADYISDRNDGDYLV
FT                   DDAGRRGGANLNRPFVLMGNLNNDEDPFRLTVQTDWADTYEINSSAIRKVLSDSYLLGS
FT                   NGRFNTDSLTPASFGAEEYKMGVGSSHIHPQVWTSLSGMRFSYVLPHKDLHIADSGVFW
FT                   PAIGESGFQWLYDDSGASDPALSSHERLVWVDVDFGRSVN"
     MQFKTLGLAL CALLLSACSD SSSTKNFTGT LRFATFHVDM AYDDSQGYFT LLQQTGATGD        60
     QQDPRLANLA AILQQTYQER QPDVLLLTGF STSVGEGGRA DDTAAVQFEQ NYLSQPQASD       120
     LTGLSYPYRY VASTNSGQFI PYDIDGDGKL SLPEDAQGPG HFHGQNSFVL LSKYALDAEQ       180
     ARTFRQFKWQ DVNGVSKPKR DDGTELDDDA WAALSVMDTN FVDIAMRLPD GRQISLLLTQ       240
     LVDQQPAEGA LRSGWAQQRN GAQLDFIADY ISDRNDGDYL VDDAGRRGGA NLNRPFVLMG       300
     NLNNDEDPFR LTVQTDWADT YEINSSAIRK VLSDSYLLGS NGRFNTDSLT PASFGAEEYK       360
     MGVGSSHIHP QVWTSLSGMR FSYVLPHKDL HIADSGVFWP AIGESGFQWL YDDSGASDPA       420
     LSSHERLVWV DVDFGRSVN                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page