(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE230

CP002209.PE230       Location/Qualifiers
FT   CDS             250441..253038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0230"
FT                   /product="peptidase S45 penicillin amidase"
FT                   /note="COGs: COG2366 Protein related to penicillin acylase;
FT                   InterPro IPR002692; KEGG: shm:Shewmr7_3263 peptidase S45,
FT                   penicillin amidase; PFAM: peptidase S45 penicillin amidase;
FT                   SPTR: A2UWX6 Peptidase S45, penicillin amidase; PFAM:
FT                   Penicillin amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74444"
FT                   /db_xref="GOA:E1SLP5"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP5"
FT                   /protein_id="ADN74444.1"
FT                   /translation="MTRKYPLILAGILTSLTLSGCSDDKDDVAVTPPPPPVVPEPEPEP
FT                   KPELVVFAPEGALEARIRRTEFGVPHITADNLESLAFGSGYAQATDHLCLLADGFIKAN
FT                   SERSKYFGPHKRIDYATGLPLVEDNQNLINDFGHLALGVRASAEAKFDALPDRSRAMLN
FT                   GFAQGYNLYLTDLASGAIETPNLPCAGQPWVKPVEGVDLLTYLFSIAHLPGSANFFDLI
FT                   FFANPGDGNEYLPVPVTPMTAATTAQYQDLTARAQRQAAQLTTPVLNERDLGSNGWGLG
FT                   ADVTENGKGIVLGNPHFPHTGQLRFWQSHLTIPDQMDVMGGSLVGMPGAINIGFNEHLA
FT                   WTHTFSTAEHFVLYQLALAEGDRMTYLLDGEPMPITATPHQIEVNVGGGQTMVLEKTLY
FT                   TTAKGPMVEAPPQAAPFTWNDNVAFFVQDANTANVDVLEHWLSMNLATDLESFQQAFRD
FT                   YDGVIFNNTMYADAEGNAFYIDDSTVPHLSETAKVALTSDRVLITLKEQAGFTILPGYD
FT                   STYGFDGAVPYEEAPKLLRSDFVQNSNNSFWSTNPAAPIEGISPLYGPERGEQSLRTRM
FT                   ALTLMSDARGDDDKFNRDEVEAALLNNRAYLAELVLDDLLSQCEAQGTTPVVVNESLSV
FT                   NVAPACAALAQWNGAQNLDSVAGALLREFGYQFNSGLLSVPFDYTDPMNTPNTLVTDGR
FT                   ALVALAVASENLTRNGFALDATLGSLQFVEKSLPDGSASGARFPWSGANNFEGGFNVFS
FT                   YSASGGDDTLLPQHAYAPAIDVVTGAPMRSRLSTEGYHVRYGSSWMMVVGFEDDGPVAR
FT                   GLLSYSESNNPLSPHWNDQTRYYSENTALRPLRFTEDAIAEALLSDQTIRHQQ"
     MTRKYPLILA GILTSLTLSG CSDDKDDVAV TPPPPPVVPE PEPEPKPELV VFAPEGALEA        60
     RIRRTEFGVP HITADNLESL AFGSGYAQAT DHLCLLADGF IKANSERSKY FGPHKRIDYA       120
     TGLPLVEDNQ NLINDFGHLA LGVRASAEAK FDALPDRSRA MLNGFAQGYN LYLTDLASGA       180
     IETPNLPCAG QPWVKPVEGV DLLTYLFSIA HLPGSANFFD LIFFANPGDG NEYLPVPVTP       240
     MTAATTAQYQ DLTARAQRQA AQLTTPVLNE RDLGSNGWGL GADVTENGKG IVLGNPHFPH       300
     TGQLRFWQSH LTIPDQMDVM GGSLVGMPGA INIGFNEHLA WTHTFSTAEH FVLYQLALAE       360
     GDRMTYLLDG EPMPITATPH QIEVNVGGGQ TMVLEKTLYT TAKGPMVEAP PQAAPFTWND       420
     NVAFFVQDAN TANVDVLEHW LSMNLATDLE SFQQAFRDYD GVIFNNTMYA DAEGNAFYID       480
     DSTVPHLSET AKVALTSDRV LITLKEQAGF TILPGYDSTY GFDGAVPYEE APKLLRSDFV       540
     QNSNNSFWST NPAAPIEGIS PLYGPERGEQ SLRTRMALTL MSDARGDDDK FNRDEVEAAL       600
     LNNRAYLAEL VLDDLLSQCE AQGTTPVVVN ESLSVNVAPA CAALAQWNGA QNLDSVAGAL       660
     LREFGYQFNS GLLSVPFDYT DPMNTPNTLV TDGRALVALA VASENLTRNG FALDATLGSL       720
     QFVEKSLPDG SASGARFPWS GANNFEGGFN VFSYSASGGD DTLLPQHAYA PAIDVVTGAP       780
     MRSRLSTEGY HVRYGSSWMM VVGFEDDGPV ARGLLSYSES NNPLSPHWND QTRYYSENTA       840
     LRPLRFTEDA IAEALLSDQT IRHQQ                                             865
//

If you have problems or comments...

PBIL Back to PBIL home page