(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE234

CP002209.PE234       Location/Qualifiers
FT   CDS             complement(255880..256677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0234"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="COGs: COG0664 cAMP-binding protein - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinase; KEGG: sfr:Sfri_3687 hypothetical protein; SPTR:
FT                   A2UY70 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74448"
FT                   /db_xref="GOA:E1SLP9"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP9"
FT                   /protein_id="ADN74448.1"
FT                   /translation="MVRAVSLNAGMKEKATIFFPGKVDDSILTFFLTHGESVNLAKGDT
FT                   VPKKTLINSFVFLREGLLFYTTRTNNYSKPKFITVIFPNRLADYHLLFDDNCTCCKGIF
FT                   AARDSEIIVINKQKIRELVQTRPDLFSQFTLDAAYYTERQTTLAVFLLTSSPEDKLLKF
FT                   LFDTLVVLDTDFSQQWLTVHLKLTRQEIADILHISVIKLDLMLGELKKQGLVRRVGNKL
FT                   QVRVDYFHPLSPCPLGREDANGCQSNNMSKFRAGNLITLNNGG"
     MVRAVSLNAG MKEKATIFFP GKVDDSILTF FLTHGESVNL AKGDTVPKKT LINSFVFLRE        60
     GLLFYTTRTN NYSKPKFITV IFPNRLADYH LLFDDNCTCC KGIFAARDSE IIVINKQKIR       120
     ELVQTRPDLF SQFTLDAAYY TERQTTLAVF LLTSSPEDKL LKFLFDTLVV LDTDFSQQWL       180
     TVHLKLTRQE IADILHISVI KLDLMLGELK KQGLVRRVGN KLQVRVDYFH PLSPCPLGRE       240
     DANGCQSNNM SKFRAGNLIT LNNGG                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page