(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE237

CP002209.PE237       Location/Qualifiers
FT   CDS             260415..261077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0237"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="COGs: COG3381 Uncharacterized component of anaerobic
FT                   dehydrogenase; InterPro IPR010395; KEGG: shm:Shewmr7_0264
FT                   cytoplasmic chaperone TorD family protein; PFAM:
FT                   cytoplasmic chaperone TorD family protein; SPTR: A2UY65
FT                   Cytoplasmic chaperone TorD; PFAM: Nitrate reductase delta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74451"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLQ2"
FT                   /protein_id="ADN74451.1"
FT                   /translation="MLAKSQLEGLEAGAHLFHSIFMKAPERHTVNQLQDKSLISAWSEI
FT                   GGAGERTETGLALLLQFVEQWQASDMQLVALKLDFSRLFIGPGQPLAPPWGSVYLDASS
FT                   LLNSESTLAFAEFLRQNDIRVAQQSNEPLDHIGIQFVVLAFLLSQLAEKPGCDTALNRS
FT                   KTLLSDFMLPWADRCLELAEYQANTQYYKGFVVLARQYLLHLRRLFGVGDTAVPLFH"
     MLAKSQLEGL EAGAHLFHSI FMKAPERHTV NQLQDKSLIS AWSEIGGAGE RTETGLALLL        60
     QFVEQWQASD MQLVALKLDF SRLFIGPGQP LAPPWGSVYL DASSLLNSES TLAFAEFLRQ       120
     NDIRVAQQSN EPLDHIGIQF VVLAFLLSQL AEKPGCDTAL NRSKTLLSDF MLPWADRCLE       180
     LAEYQANTQY YKGFVVLARQ YLLHLRRLFG VGDTAVPLFH                             220
//

If you have problems or comments...

PBIL Back to PBIL home page