(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE238

CP002209.PE238       Location/Qualifiers
FT   CDS             261077..261544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_0630 hypothetical protein; SPTR:
FT                   A2UWL2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74452"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLQ3"
FT                   /protein_id="ADN74452.1"
FT                   /translation="MSFIGAVGQQWQKAQLSQRLQLALMPRPSLNYLFTGATDRETLSH
FT                   LVAALVFSEGKPDWLVLDAEHERQPLSAWDTMDCLLLSCTLLSTRACSPEGLSQAEQLV
FT                   MTLAEVWASELERHVDHGDAKRDGCEALLRLIAALKVQQQVRRQRSRNMTG"
     MSFIGAVGQQ WQKAQLSQRL QLALMPRPSL NYLFTGATDR ETLSHLVAAL VFSEGKPDWL        60
     VLDAEHERQP LSAWDTMDCL LLSCTLLSTR ACSPEGLSQA EQLVMTLAEV WASELERHVD       120
     HGDAKRDGCE ALLRLIAALK VQQQVRRQRS RNMTG                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page