(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE24

CP002209.PE24        Location/Qualifiers
FT   CDS             29544..30641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0024"
FT                   /product="Peptidoglycan-binding lysin domain protein"
FT                   /note="InterPro IPR018392: IPR002482; KEGG: slo:Shew_3735
FT                   peptidoglycan-binding LysM; PFAM: Peptidoglycan-binding
FT                   lysin domain; SMART: Peptidoglycan-binding LysM; SPTR:
FT                   A2V469 Peptidoglycan-binding LysM; PFAM: LysM domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74238"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV84"
FT                   /protein_id="ADN74238.1"
FT                   /translation="MRIAIIMLAALLSLPLAADTLTLKPGHPQTYVVKKGDTLWDISAL
FT                   FLDDPWRWPTLWGANPQIANPHLIYPGDRLNLVYLDGQPRLVRKPMKRMSPQMDVQQKG
FT                   GAIPALPLSMIEPYLSFQQILGEKALADTPQVIGGERDAVRYAKGDVVFINERLPLGEK
FT                   FGIYMLARRFVDPDTKEFLGQEALMTATGRVIESGTVSRIELLSMRQEVKTGHRVMALE
FT                   DDLLLPAYMMPTAAPHGADGRVIASDAMVREIGPLEVAIINRGSEDGAAAGQVYAISKE
FT                   GTEVVEQGDGEFVQPEDRRAYDEMVATLSDGRTIKQPEVYRGELMLFKTYDRVSLGLIV
FT                   NGRHPVRLLDVLSRPEPLVFGSDSD"
     MRIAIIMLAA LLSLPLAADT LTLKPGHPQT YVVKKGDTLW DISALFLDDP WRWPTLWGAN        60
     PQIANPHLIY PGDRLNLVYL DGQPRLVRKP MKRMSPQMDV QQKGGAIPAL PLSMIEPYLS       120
     FQQILGEKAL ADTPQVIGGE RDAVRYAKGD VVFINERLPL GEKFGIYMLA RRFVDPDTKE       180
     FLGQEALMTA TGRVIESGTV SRIELLSMRQ EVKTGHRVMA LEDDLLLPAY MMPTAAPHGA       240
     DGRVIASDAM VREIGPLEVA IINRGSEDGA AAGQVYAISK EGTEVVEQGD GEFVQPEDRR       300
     AYDEMVATLS DGRTIKQPEV YRGELMLFKT YDRVSLGLIV NGRHPVRLLD VLSRPEPLVF       360
     GSDSD                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page