(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE243

CP002209.PE243       Location/Qualifiers
FT   CDS             complement(272203..273141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0243"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="COGs: COG1072 Panthothenate kinase; InterPro
FT                   IPR004566; KEGG: slo:Shew_0143 pantothenate kinase; SPTR:
FT                   A3Q967 Pantothenate kinase; TIGRFAM: pantothenate kinase;
FT                   PFAM: Phosphoribulokinase / Uridine kinase family; TIGRFAM:
FT                   pantothenate kinase, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74457"
FT                   /db_xref="GOA:E1SLQ8"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLQ8"
FT                   /protein_id="ADN74457.1"
FT                   /translation="MNAQTKLGAYQGFSRREWAALRDAVPLPLSEEELERLRGINESVS
FT                   LEEVEAVYLPLSRLLNLYVHSSQRRGDVLQQFLGRRPSKGPYIISVAGSVAVGKSTTAR
FT                   ILQALLQRWPEHPQVELVTTDGFLYPLEELKRRDLLKRKGFPESYDIRMLLDFVKEVKS
FT                   GRRTAAPLYSHLSYDRIENTQQEINNPDILILEGLNVLQSGMDYPDGDRPFVSDFVDFS
FT                   IYVDAPESLLKSWYIDRFISFRDGAFKDPNSYFHHYAQLSEGEARKTASKIWDDINGPN
FT                   LNNNILPTRERATLILSKGEHHRIEKIRLRG"
     MNAQTKLGAY QGFSRREWAA LRDAVPLPLS EEELERLRGI NESVSLEEVE AVYLPLSRLL        60
     NLYVHSSQRR GDVLQQFLGR RPSKGPYIIS VAGSVAVGKS TTARILQALL QRWPEHPQVE       120
     LVTTDGFLYP LEELKRRDLL KRKGFPESYD IRMLLDFVKE VKSGRRTAAP LYSHLSYDRI       180
     ENTQQEINNP DILILEGLNV LQSGMDYPDG DRPFVSDFVD FSIYVDAPES LLKSWYIDRF       240
     ISFRDGAFKD PNSYFHHYAQ LSEGEARKTA SKIWDDINGP NLNNNILPTR ERATLILSKG       300
     EHHRIEKIRL RG                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page