(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE254

CP002209.PE254       Location/Qualifiers
FT   CDS             287761..288231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0254"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="COGs: COG0049 Ribosomal protein S7; InterPro
FT                   IPR000235: IPR005717; KEGG: pat:Patl_0601 30S ribosomal
FT                   protein S7; PFAM: ribosomal protein S7; SPTR: Q3ILP6 30S
FT                   ribosomal protein S7; TIGRFAM: ribosomal protein S7; PFAM:
FT                   Ribosomal protein S7p/S5e; TIGRFAM: ribosomal protein S7,
FT                   bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74468"
FT                   /db_xref="GOA:E1SLR9"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLR9"
FT                   /protein_id="ADN74468.1"
FT                   /translation="MPRRRVVGQRKILPDPKFGSELLAKFVNVVMLDGKKSTAEKIIYG
FT                   GLAAASEKAGKSELEIFETALDNIRPTVEVKSRRVGGSTYQVPVEVRPVRRNTLAMRWL
FT                   VEAARKRSEKSMALRLAGELLDASENKGSAVKKREDVHRMAEANKAFAHYRW"
     MPRRRVVGQR KILPDPKFGS ELLAKFVNVV MLDGKKSTAE KIIYGGLAAA SEKAGKSELE        60
     IFETALDNIR PTVEVKSRRV GGSTYQVPVE VRPVRRNTLA MRWLVEAARK RSEKSMALRL       120
     AGELLDASEN KGSAVKKRED VHRMAEANKA FAHYRW                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page