(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE256

CP002209.PE256       Location/Qualifiers
FT   CDS             290492..291676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0256"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="COGs: COG0050 GTPase - translation elongation
FT                   factors; InterPro IPR000795: IPR004160: IPR004161:
FT                   IPR005225: IPR 004541; KEGG: swd:Swoo_4704 elongation
FT                   factor Tu; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain protein; elongation factor Tu
FT                   domain 2 protein; SPTR: A3Q968 Elongation factor Tu 1;
FT                   TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: Elongation factor Tu C-terminal
FT                   domain; Elongation factor Tu domain 2; Elongation factor Tu
FT                   GTP binding domain; TIGRFAM: small GTP-binding protein
FT                   domain; translation elongation factor TU"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74470"
FT                   /db_xref="GOA:E1SLS1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLS1"
FT                   /protein_id="ADN74470.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITNVLAKANGGQAR
FT                   AFDQIDNAPEERERGITIAASHVEYDTETRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCAATDGPMPQTREHILLSRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSEYDF
FT                   PGDDTPVIQGSALKALEGDAQWEAKILELAEALDTYIPEPERAVDGAFLLPIEDVFSIQ
FT                   GRGTVVTGRVERGIVKVGDEVEIVGIKDTAKTTCTGVEMFRKLLDEGRAGENCGVLLRG
FT                   TKREEVERGQVLAQPGSITPHTKFTSEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDITG
FT                   TIELPEGVEMVMPGDNIQMTVTLIAPIAMEEGLRFAIREGGRTVGAGVVAKIVE"
     MSKEKFERTK PHVNVGTIGH VDHGKTTLTA AITNVLAKAN GGQARAFDQI DNAPEERERG        60
     ITIAASHVEY DTETRHYAHV DCPGHADYVK NMITGAAQMD GAILVCAATD GPMPQTREHI       120
     LLSRQVGVPY IIVFLNKCDM VDDEELLELV EMEVRELLSE YDFPGDDTPV IQGSALKALE       180
     GDAQWEAKIL ELAEALDTYI PEPERAVDGA FLLPIEDVFS IQGRGTVVTG RVERGIVKVG       240
     DEVEIVGIKD TAKTTCTGVE MFRKLLDEGR AGENCGVLLR GTKREEVERG QVLAQPGSIT       300
     PHTKFTSEVY VLSKEEGGRH TPFFKGYRPQ FYFRTTDITG TIELPEGVEM VMPGDNIQMT       360
     VTLIAPIAME EGLRFAIREG GRTVGAGVVA KIVE                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page