(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE257

CP002209.PE257       Location/Qualifiers
FT   CDS             291841..292719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0257"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; InterPro IPR001173; KEGG:
FT                   ppd:Ppro_3338 glycosyl transferase family protein; PFAM:
FT                   glycosyl transferase family 2; SPTR: B8GDZ0 Glycosyl
FT                   transferase family 2; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74471"
FT                   /db_xref="GOA:E1SLS2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLS2"
FT                   /protein_id="ADN74471.1"
FT                   /translation="MQVERTDEHPPAESAAPICNEQRCQISVLIASLGRPSLITALQSI
FT                   FGRSSVRFEVVLVLDDPDVSAERLLAEIPPARRRAIRVIQNPENLGLTRSLNRGLAQCR
FT                   GEFIARLDDDDRFSPERLDQVVERFQAHPEVGVIVSDTRVIDGERHYQLTVPAEHDAIA
FT                   EALQHRNILVHSAFNIRRTVLQRVGGYNEAYRYAQDYELYLRLLRHGVRFMGVNQPLAE
FT                   RNEEEGTITVSRRQHQALFSLSALCLHHASTWRGDGDQVRAICTAFARFVAPKSLRKGV
FT                   RWLRAVSRGEG"
     MQVERTDEHP PAESAAPICN EQRCQISVLI ASLGRPSLIT ALQSIFGRSS VRFEVVLVLD        60
     DPDVSAERLL AEIPPARRRA IRVIQNPENL GLTRSLNRGL AQCRGEFIAR LDDDDRFSPE       120
     RLDQVVERFQ AHPEVGVIVS DTRVIDGERH YQLTVPAEHD AIAEALQHRN ILVHSAFNIR       180
     RTVLQRVGGY NEAYRYAQDY ELYLRLLRHG VRFMGVNQPL AERNEEEGTI TVSRRQHQAL       240
     FSLSALCLHH ASTWRGDGDQ VRAICTAFAR FVAPKSLRKG VRWLRAVSRG EG               292
//

If you have problems or comments...

PBIL Back to PBIL home page