(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE26

CP002209.PE26        Location/Qualifiers
FT   CDS             31725..32204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0026"
FT                   /product="protein of unknown function DUF494"
FT                   /note="COGs: COG2922 conserved hypothetical protein;
FT                   InterPro IPR007456; KEGG: cps:CPS_0023 smg protein; PFAM:
FT                   protein of unknown function DUF494; SPTR: Q48AU5 Protein
FT                   smg homolog; PFAM: Protein of unknown function (DUF494)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74240"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV86"
FT                   /protein_id="ADN74240.1"
FT                   /translation="MIMFDILMYLFETYVQSDVELLFDREELTDELSRAGFRSDEIGKA
FT                   LIWIEKLAALQDSDRHPYLTGVEPGSFRIYTAEEVARLDTESRGFLMFLEQIQVLSATT
FT                   REMVIDRVMELDGEPLSLDDLKWVVLMVLFNAPGNEQAYTQMEDLIFEEPEGLLH"
     MIMFDILMYL FETYVQSDVE LLFDREELTD ELSRAGFRSD EIGKALIWIE KLAALQDSDR        60
     HPYLTGVEPG SFRIYTAEEV ARLDTESRGF LMFLEQIQVL SATTREMVID RVMELDGEPL       120
     SLDDLKWVVL MVLFNAPGNE QAYTQMEDLI FEEPEGLLH                              159
//

If you have problems or comments...

PBIL Back to PBIL home page