(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE263

CP002209.PE263       Location/Qualifiers
FT   CDS             298867..303123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0263"
FT                   /product="Kelch repeat protein"
FT                   /note="InterPro IPR011498: IPR006652; KEGG: actin binding
FT                   protein ; K10442 kelch-like protein 1/4/5; PFAM: Kelch
FT                   repeat protein; Kelch repeat-containing protein; SMART:
FT                   Kelch repeat-containing protein; SPTR: A9A4Q1 Kelch repeat
FT                   protein; PFAM: Kelch motif"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74477"
FT                   /db_xref="GOA:E1SLS8"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR024361"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLS8"
FT                   /protein_id="ADN74477.1"
FT                   /translation="MLSLFRGRFGALLALLFLSFSLHAELRVSQLPDKSVSEPLNGAEI
FT                   SGTVYIFYQPSQPLSQVKFYLDTAVGGKTFQTENIAPYDFAGTASGGAGNPFDADSLSG
FT                   GSHTIAVLVTPQSGSAFEASATFTVGDGGGGTTPTLNFASDSQSFSVTGEQQQTGSVAL
FT                   SLSDGSSATANLSSSASWLTLDSSTQAVPGSVGFQVDSTGLGVGSYSATITASVTGYPS
FT                   VSHGVSLTVLSSGSSGYSLLVSTQPDRSGAVPLGGQSLSGPVYIFTSPDNGVSKVRFYL
FT                   DNPGLSGSSTKTEGVAPYDFAGTAPDRTAYPFNVDGLSDGLHTIDVELVTTNGSQYTQG
FT                   SFVVGEEVVSLLASPTSISLSGEIDSGILSATAQVTASDGSNLVFSEEHDAAWLSLDLG
FT                   GDSTPATVTFSVDTNGLSAGSYSDTVTLFSTGVGSAQVTVALTLTDPNGGGGGGGGGTG
FT                   ELCGPVLCSDVKVTLPYVLEFDDSVEGYLDGNGIGTGFTYLQPTSKGSGYLPDNLDVNT
FT                   STERLVVTTTKGLQHQSINNLDNALGVGYAGPNHIARISTVLVEPPAGSGKYEQAGLWF
FT                   GYDEDHFIKLVYNSAGGGPVVEFIYESAGSVQGKFDANVGDLSSDTLTLALVANPETQS
FT                   ISARYSINGGSETNLGSFDIAPEFFSFDAAGIDPVIGTRTFTGIMASHRNGASALVYQF
FT                   ESFSVESLGAPGSGGGGSGGGGSGGGSADWSFSKVSSHPLDFPTAMVWGPDNRLYVTEL
FT                   FGTIHALTFDDQLRVVDDQVITGLTDRHGSRMTLGIEVYHDDPSDPNGFSLWVNHSSAS
FT                   TNNGIINSGEVTRLFGDNFAESEVVISGLPRAKANHGPNSLHFGPDNRLYIAIGGITGA
FT                   GAAVDPNVANTEFGDRAEQPLSAAILVADVFAAGFDGTCDNSPDIFGPNPCDVVTWVTG
FT                   LRNTYDFVFHSNGQAYATDNGLGVKGAYPPKPTPDCSGFGDPAPYDEGGDNPGTQPDLL
FT                   LKLEAGEYYGHPNPTRDECVFKDGSYQNVAPLPNYQPEIFSLGNNKSANGIVELRSNRA
FT                   CGALNGDLMVTYYSKDDGVTRLQLNADGDQVVLAEKLFADLVDPLPLAARNGDIYVGEF
FT                   GAGVVSVLALASTPCWDAGADAPAELLDSGSAILNGKLHVVGGKTASGHVNTHYAYDIG
FT                   ADSWQTLAAKPGTAVENGAVAAYNGALYVFGGSSGPFNGAVTESYRYDPGSNSWQALAP
FT                   MPVALGGIRAEAIGDEIYIAGGMNGSGASVASLLVYDPGSNSWRTGPSMSQVRDNPGTA
FT                   VLNGELYVLGGRHRLADGTSLDGQLNTMEIYNPSSNQWRRGPDLLTGRRTFAVGTINGR
FT                   IQVLGGEYASGVTNNVFPQYEEFDPGSNQWQYLGDALFPTHGAAFGTFGDQLILSTGGP
FT                   IGGTSFSNDTYRVSGQ"
     MLSLFRGRFG ALLALLFLSF SLHAELRVSQ LPDKSVSEPL NGAEISGTVY IFYQPSQPLS        60
     QVKFYLDTAV GGKTFQTENI APYDFAGTAS GGAGNPFDAD SLSGGSHTIA VLVTPQSGSA       120
     FEASATFTVG DGGGGTTPTL NFASDSQSFS VTGEQQQTGS VALSLSDGSS ATANLSSSAS       180
     WLTLDSSTQA VPGSVGFQVD STGLGVGSYS ATITASVTGY PSVSHGVSLT VLSSGSSGYS       240
     LLVSTQPDRS GAVPLGGQSL SGPVYIFTSP DNGVSKVRFY LDNPGLSGSS TKTEGVAPYD       300
     FAGTAPDRTA YPFNVDGLSD GLHTIDVELV TTNGSQYTQG SFVVGEEVVS LLASPTSISL       360
     SGEIDSGILS ATAQVTASDG SNLVFSEEHD AAWLSLDLGG DSTPATVTFS VDTNGLSAGS       420
     YSDTVTLFST GVGSAQVTVA LTLTDPNGGG GGGGGGTGEL CGPVLCSDVK VTLPYVLEFD       480
     DSVEGYLDGN GIGTGFTYLQ PTSKGSGYLP DNLDVNTSTE RLVVTTTKGL QHQSINNLDN       540
     ALGVGYAGPN HIARISTVLV EPPAGSGKYE QAGLWFGYDE DHFIKLVYNS AGGGPVVEFI       600
     YESAGSVQGK FDANVGDLSS DTLTLALVAN PETQSISARY SINGGSETNL GSFDIAPEFF       660
     SFDAAGIDPV IGTRTFTGIM ASHRNGASAL VYQFESFSVE SLGAPGSGGG GSGGGGSGGG       720
     SADWSFSKVS SHPLDFPTAM VWGPDNRLYV TELFGTIHAL TFDDQLRVVD DQVITGLTDR       780
     HGSRMTLGIE VYHDDPSDPN GFSLWVNHSS ASTNNGIINS GEVTRLFGDN FAESEVVISG       840
     LPRAKANHGP NSLHFGPDNR LYIAIGGITG AGAAVDPNVA NTEFGDRAEQ PLSAAILVAD       900
     VFAAGFDGTC DNSPDIFGPN PCDVVTWVTG LRNTYDFVFH SNGQAYATDN GLGVKGAYPP       960
     KPTPDCSGFG DPAPYDEGGD NPGTQPDLLL KLEAGEYYGH PNPTRDECVF KDGSYQNVAP      1020
     LPNYQPEIFS LGNNKSANGI VELRSNRACG ALNGDLMVTY YSKDDGVTRL QLNADGDQVV      1080
     LAEKLFADLV DPLPLAARNG DIYVGEFGAG VVSVLALAST PCWDAGADAP AELLDSGSAI      1140
     LNGKLHVVGG KTASGHVNTH YAYDIGADSW QTLAAKPGTA VENGAVAAYN GALYVFGGSS      1200
     GPFNGAVTES YRYDPGSNSW QALAPMPVAL GGIRAEAIGD EIYIAGGMNG SGASVASLLV      1260
     YDPGSNSWRT GPSMSQVRDN PGTAVLNGEL YVLGGRHRLA DGTSLDGQLN TMEIYNPSSN      1320
     QWRRGPDLLT GRRTFAVGTI NGRIQVLGGE YASGVTNNVF PQYEEFDPGS NQWQYLGDAL      1380
     FPTHGAAFGT FGDQLILSTG GPIGGTSFSN DTYRVSGQ                              1418
//

If you have problems or comments...

PBIL Back to PBIL home page