(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE275

CP002209.PE275       Location/Qualifiers
FT   CDS             312302..312991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0275"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="COGs: COG0092 Ribosomal protein S3; InterPro
FT                   IPR004044: IPR001351: IPR008282: IPR004087: IPR 004088:
FT                   IPR018280: IPR005704; KEGG: pin:Ping_3518 ribosomal protein
FT                   S3; PFAM: ribosomal protein S3- domain protein; KH type 2
FT                   domain protein; Ribosomal protein S3 domain; SMART: KH
FT                   domain protein; SPTR: A1T0D6 30S ribosomal protein S3;
FT                   TIGRFAM: ribosomal protein S3; PFAM: KH domain; Ribosomal
FT                   protein S3, C-terminal domain; Ribosomal protein S3,
FT                   N-terminal domain; TIGRFAM: ribosomal protein S3, bacterial
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74489"
FT                   /db_xref="GOA:E1SLU0"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLU0"
FT                   /protein_id="ADN74489.1"
FT                   /translation="MGQKVHPNGIRLGITKPWSSTWYAEKKDYADNLFSDHEVRQFLKQ
FT                   ELKNASVSRITIERPAKSIRVTIHTARPGVVIGKKGEDVEKLRLKVAKLAGVPAQINIS
FT                   EVRKPELDAQLVGDSVASQLERRVMFRRAMKRAVQNAMRLGAKGIKIEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYATSEAHTTYGVIGIKVWIFKGEVLGGMPVVAEEPKAQP
FT                   KRKGRGK"
     MGQKVHPNGI RLGITKPWSS TWYAEKKDYA DNLFSDHEVR QFLKQELKNA SVSRITIERP        60
     AKSIRVTIHT ARPGVVIGKK GEDVEKLRLK VAKLAGVPAQ INISEVRKPE LDAQLVGDSV       120
     ASQLERRVMF RRAMKRAVQN AMRLGAKGIK IEVSGRLGGA EIARTEWYRE GRVPLHTLRA       180
     DIDYATSEAH TTYGVIGIKV WIFKGEVLGG MPVVAEEPKA QPKRKGRGK                   229
//

If you have problems or comments...

PBIL Back to PBIL home page