(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE279

CP002209.PE279       Location/Qualifiers
FT   CDS             314019..314387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0279"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="COGs: COG0093 Ribosomal protein L14; InterPro
FT                   IPR000218: IPR019972: IPR005745; KEGG: sfr:Sfri_0158 50S
FT                   ribosomal protein L14; PFAM: ribosomal protein L14b/L23e;
FT                   SPTR: Q089P4 50S ribosomal protein L14; TIGRFAM: ribosomal
FT                   protein L14; PFAM: Ribosomal protein L14p/L23e; TIGRFAM:
FT                   ribosomal protein L14, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74493"
FT                   /db_xref="GOA:E1SLU4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLU4"
FT                   /protein_id="ADN74493.1"
FT                   /translation="MIQMQSVLDVADNSGARSVQCIKVLGGSHRRYAGIGDIIKVSVKE
FT                   SIPRGKAKKGDVYNAVVVRTKKGVRRPDGSVIRFDRNAAVLLNANLQPIGTRIFGPVTR
FT                   ELRNDKFMKIVSLAPEVL"
     MIQMQSVLDV ADNSGARSVQ CIKVLGGSHR RYAGIGDIIK VSVKESIPRG KAKKGDVYNA        60
     VVVRTKKGVR RPDGSVIRFD RNAAVLLNAN LQPIGTRIFG PVTRELRNDK FMKIVSLAPE       120
     VL                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page