(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE28

CP002209.PE28        Location/Qualifiers
FT   CDS             34048..34614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0028"
FT                   /product="DNA topoisomerase type IA zn finger domain
FT                   protein"
FT                   /note="COGs: COG0551 Zn-finger domain associated with
FT                   topoisomerase type I; InterPro IPR013498; KEGG:
FT                   shm:Shewmr7_0031 DNA topoisomerase type IA Zn finger
FT                   domain-containing protein; PFAM: DNA topoisomerase type IA
FT                   zn finger domain protein; SPTR: A2V466 DNA topoisomerase,
FT                   type IA, zn finger; PFAM: Topoisomerase DNA binding C4 zinc
FT                   finger"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74242"
FT                   /db_xref="GOA:E1SV88"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV88"
FT                   /protein_id="ADN74242.1"
FT                   /translation="MSKIDQQLFTTHEHALEREYGVCPECGSELAVRHGKHGAFLGCQS
FT                   YPTCEYHRPLVEKTTVEAEILEGTECPLCGHPLALKSGRYGFYIGCSDFPQCHYIAKDE
FT                   PETPATKVACPSCRSGELMERTNRFGKKFYACSGYPKCKYLLNFPPVAEPCPDCGWPLL
FT                   VEKNVRGQRRWVCPQRSCKYQSETI"
     MSKIDQQLFT THEHALEREY GVCPECGSEL AVRHGKHGAF LGCQSYPTCE YHRPLVEKTT        60
     VEAEILEGTE CPLCGHPLAL KSGRYGFYIG CSDFPQCHYI AKDEPETPAT KVACPSCRSG       120
     ELMERTNRFG KKFYACSGYP KCKYLLNFPP VAEPCPDCGW PLLVEKNVRG QRRWVCPQRS       180
     CKYQSETI                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page