(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE287

CP002209.PE287       Location/Qualifiers
FT   CDS             317422..317601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0287"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="COGs: COG1841 Ribosomal protein L30/L7E; InterPro
FT                   IPR000517: IPR018038: IPR005996; KEGG: yen:YE3905 50S
FT                   ribosomal protein L30; PFAM: ribosomal protein L30; SPTR:
FT                   B1JIX9 50S ribosomal protein L30; TIGRFAM: ribosomal
FT                   protein L30; PFAM: Ribosomal protein L30p/L7e; TIGRFAM:
FT                   ribosomal protein L30, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74501"
FT                   /db_xref="GOA:E1SLV2"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLV2"
FT                   /protein_id="ADN74501.1"
FT                   /translation="MAKTIKVTQTKSSIGRLPKHKATLVGLGLRKIGHTVELEDTASVR
FT                   GMINKVSYMVKVEE"
     MAKTIKVTQT KSSIGRLPKH KATLVGLGLR KIGHTVELED TASVRGMINK VSYMVKVEE         59
//

If you have problems or comments...

PBIL Back to PBIL home page