(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE29

CP002209.PE29        Location/Qualifiers
FT   CDS             34665..35171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0029"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="COGs: COG0041 Phosphoribosylcarboxyaminoimidazole
FT                   (NCAIR) mutase; InterPro IPR000031; KEGG: swp:swp_1396
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit, putative; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; PRIAM: Phosphoribosylaminoimidazole
FT                   carboxylase; SPTR: A0Y9A3 Hypothetical
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit; PFAM: AIR carboxylase; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, PurE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74243"
FT                   /db_xref="GOA:E1SV89"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV89"
FT                   /protein_id="ADN74243.1"
FT                   /translation="MSTPFVAVLMGSDSDLPTMQSTLDVLKGFGIRYEAKVTSAHRTPA
FT                   ATHAYVQDAEARGCKVFICAAGLAAHLAGAVAGITTRPVIGVPIDNGPLQGHDALLSTV
FT                   MMPGGVPVATVAIGSAGAKNAGYLAAQMLAVGDDELAAAVKAERQKSAEAVQAKDAALQ
FT                   AKLAG"
     MSTPFVAVLM GSDSDLPTMQ STLDVLKGFG IRYEAKVTSA HRTPAATHAY VQDAEARGCK        60
     VFICAAGLAA HLAGAVAGIT TRPVIGVPID NGPLQGHDAL LSTVMMPGGV PVATVAIGSA       120
     GAKNAGYLAA QMLAVGDDEL AAAVKAERQK SAEAVQAKDA ALQAKLAG                    168
//

If you have problems or comments...

PBIL Back to PBIL home page