(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE290

CP002209.PE290       Location/Qualifiers
FT   CDS             319396..319509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0290"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="InterPro IPR000473; KEGG: vsp:VS_2810.1 50S
FT                   ribosomal protein L36; PFAM: ribosomal protein L36; SPTR:
FT                   A3V0F4 50S ribosomal protein L36; TIGRFAM: ribosomal
FT                   protein L36; PFAM: Ribosomal protein L36; TIGRFAM:
FT                   ribosomal protein L36, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74504"
FT                   /db_xref="GOA:E1SME9"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:E1SME9"
FT                   /protein_id="ADN74504.1"
FT                   /translation="MKVRASVKKMCRNCKVIKRNGVVRVICSEPKHKQRQG"
     MKVRASVKKM CRNCKVIKRN GVVRVICSEP KHKQRQG                                 37
//

If you have problems or comments...

PBIL Back to PBIL home page