(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE291

CP002209.PE291       Location/Qualifiers
FT   CDS             319649..320005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0291"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="COGs: COG0099 Ribosomal protein S13; InterPro
FT                   IPR001892: IPR018269: IPR019980; KEGG: tau:Tola_0121
FT                   ribosomal protein S13; PFAM: ribosomal protein S13; SPTR:
FT                   A4SSY4 30S ribosomal protein S13; TIGRFAM: 30S ribosomal
FT                   protein S13; PFAM: Ribosomal protein S13/S18; TIGRFAM: 30S
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74505"
FT                   /db_xref="GOA:E1SMF0"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMF0"
FT                   /protein_id="ADN74505.1"
FT                   /translation="MARIAGINIPEHKHAVVALTAIFGIGQTRAKAICVEAGIAEDVKF
FT                   KDLDEATIDKVREVVGQFTVEGDLRREISMNIKRLMDLGCFRGLRHRRSLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
     MARIAGINIP EHKHAVVALT AIFGIGQTRA KAICVEAGIA EDVKFKDLDE ATIDKVREVV        60
     GQFTVEGDLR REISMNIKRL MDLGCFRGLR HRRSLPVRGQ RTKTNARTRK GPRKPIKK         118
//

If you have problems or comments...

PBIL Back to PBIL home page