(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE293

CP002209.PE293       Location/Qualifiers
FT   CDS             320437..321057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0293"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="COGs: COG0522 Ribosomal protein S4 and related
FT                   protein; InterPro IPR001912: IPR002942: IPR018079:
FT                   IPR005709; KEGG: aha:AHA_0332 ribosomal protein S4; PFAM:
FT                   ribosomal protein S4; RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein; SPTR: A0KF44 30S ribosomal
FT                   protein S4; TIGRFAM: ribosomal protein S4; PFAM: Ribosomal
FT                   protein S4/S9 N-terminal domain; S4 domain; TIGRFAM:
FT                   ribosomal protein S4, bacterial/organelle type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74507"
FT                   /db_xref="GOA:E1SMF2"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMF2"
FT                   /protein_id="ADN74507.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDSKCKIDTVPGQHGARR
FT                   ARLSDYGVQLREKQKVRRMYGVLEKQFRNYYKEAARLKGNTGENLLQLLESRLDNVVYR
FT                   MGFGATRAEARQLVSHKAIKVNGRVVNIPSFSVSPNDVIAVREKAQKQARIKGALEVAE
FT                   QREKPTWVEVDGAKMEGTFKRLPERSDLSADINEQLIVELYSK"
     MARYLGPKLK LSRREGTDLF LKSGVRAIDS KCKIDTVPGQ HGARRARLSD YGVQLREKQK        60
     VRRMYGVLEK QFRNYYKEAA RLKGNTGENL LQLLESRLDN VVYRMGFGAT RAEARQLVSH       120
     KAIKVNGRVV NIPSFSVSPN DVIAVREKAQ KQARIKGALE VAEQREKPTW VEVDGAKMEG       180
     TFKRLPERSD LSADINEQLI VELYSK                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page