(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE295

CP002209.PE295       Location/Qualifiers
FT   CDS             322114..322515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0295"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="COGs: COG0203 Ribosomal protein L17; InterPro
FT                   IPR000456; KEGG: ilo:IL1890 50S ribosomal protein L17;
FT                   PFAM: ribosomal protein L17; SPTR: Q5QXV0 50S ribosomal
FT                   protein L17; TIGRFAM: ribosomal protein L17; PFAM:
FT                   Ribosomal protein L17; TIGRFAM: ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74509"
FT                   /db_xref="GOA:E1SMF4"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMF4"
FT                   /protein_id="ADN74509.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRHEVIKTTLPKAKELR
FT                   RVVEPLITLAKTDSVANRRLAFARTRDQFVVGKLFNELGPRYQERAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRPAAEEVAEEAQASAE"
     MRHRKSGRQL NRNSSHRQAM FRNMAGSLVR HEVIKTTLPK AKELRRVVEP LITLAKTDSV        60
     ANRRLAFART RDQFVVGKLF NELGPRYQER AGGYTRILKC GFRAGDNAPM AYIELVDRPA       120
     AEEVAEEAQA SAE                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page