(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE296

CP002209.PE296       Location/Qualifiers
FT   CDS             complement(323098..323580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0296"
FT                   /product="CcmE/CycJ protein"
FT                   /note="COGs: COG2332 Cytochrome c-type biogenesis protein
FT                   CcmE; InterPro IPR004329; KEGG: ppr:PBPRA0951 cytochrome
FT                   c-type biogenesis protein CcmE; PFAM: CcmE/CycJ protein;
FT                   SPTR: Q6LTL4 Cytochrome c-type biogenesis protein ccmE;
FT                   PFAM: CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74510"
FT                   /db_xref="GOA:E1SMF5"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMF5"
FT                   /protein_id="ADN74510.1"
FT                   /translation="MNPRRKKRLVFASALIGGVAAIASLLIYALNSNLDLFFTATEVVQ
FT                   GRQDGLKPEVGQRIRIGGMVVEGSVERDPNSLKIAFQVADTGPAVTVLYDGMLPDLFRE
FT                   GQGIVAQGTLVDSTTLEASEVLAKHDENYMSPEIAEAMGKSHEQMEYSESQTGGGY"
     MNPRRKKRLV FASALIGGVA AIASLLIYAL NSNLDLFFTA TEVVQGRQDG LKPEVGQRIR        60
     IGGMVVEGSV ERDPNSLKIA FQVADTGPAV TVLYDGMLPD LFREGQGIVA QGTLVDSTTL       120
     EASEVLAKHD ENYMSPEIAE AMGKSHEQME YSESQTGGGY                             160
//

If you have problems or comments...

PBIL Back to PBIL home page