(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE302

CP002209.PE302       Location/Qualifiers
FT   CDS             complement(326573..327823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0302"
FT                   /product="cytochrome c-type biogenesis protein CcmI"
FT                   /note="COGs: COG4235 Cytochrome c biogenesis factor;
FT                   InterPro IPR019734: IPR013026: IPR017560; KEGG:
FT                   shm:Shewmr7_0228 TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide repeat; SPTR: A2UXA3 TPR repeat; TIGRFAM:
FT                   cytochrome c-type biogenesis protein CcmI; PFAM:
FT                   Tetratricopeptide repeat; TIGRFAM: cytochrome c-type
FT                   biogenesis protein CcmI"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74516"
FT                   /db_xref="GOA:E1SMG1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017560"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMG1"
FT                   /protein_id="ADN74516.1"
FT                   /translation="MTTFWFGIAVLSALALFTIWLPFWRRQKALAAASDAQVRKQTNLS
FT                   LFNERLKELETDLAEGRINEQEFEDFKKELQLNLLQNTEQEDHVLDAKKPSILWPAIMS
FT                   VALLAVAGYTYHDLGRYSDWQNAQVGGNDPHAGMNPDQLMQMRLAQMEQAVQADPSNSQ
FT                   AWFSLGHAYISASQYTKAIEAFDTVMSLVGEHAELLGPKATAMYYLNGQKMNPEIQGIV
FT                   EKALADDNKDPSTRLLLGMDAFFNANYETAIEHWEIILTSPREDVDRQAILGAISQARM
FT                   HLEQSGAAMGGETAAPEQAATTGKTLTVTVELADAVKAQANQSDSLFLFARPVSGPAMP
FT                   VAVARLNVADLPTQVVLDDSTAMSPDMVISAHSQVNLVATINHDGSPAPTPGDLLGELN
FT                   AVDLGTQVTLVIDTIVE"
     MTTFWFGIAV LSALALFTIW LPFWRRQKAL AAASDAQVRK QTNLSLFNER LKELETDLAE        60
     GRINEQEFED FKKELQLNLL QNTEQEDHVL DAKKPSILWP AIMSVALLAV AGYTYHDLGR       120
     YSDWQNAQVG GNDPHAGMNP DQLMQMRLAQ MEQAVQADPS NSQAWFSLGH AYISASQYTK       180
     AIEAFDTVMS LVGEHAELLG PKATAMYYLN GQKMNPEIQG IVEKALADDN KDPSTRLLLG       240
     MDAFFNANYE TAIEHWEIIL TSPREDVDRQ AILGAISQAR MHLEQSGAAM GGETAAPEQA       300
     ATTGKTLTVT VELADAVKAQ ANQSDSLFLF ARPVSGPAMP VAVARLNVAD LPTQVVLDDS       360
     TAMSPDMVIS AHSQVNLVAT INHDGSPAPT PGDLLGELNA VDLGTQVTLV IDTIVE           416
//

If you have problems or comments...

PBIL Back to PBIL home page