(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE303

CP002209.PE303       Location/Qualifiers
FT   CDS             328236..330200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0303"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="COGs: COG1138 Cytochrome c biogenesis factor;
FT                   InterPro IPR003567: IPR003568: IPR003570: IPR002541; KEGG:
FT                   swp:swp_2046 cytochrome c-type biogenesis protein CcmF;
FT                   PFAM: cytochrome c assembly protein; SPTR: A2UXA4
FT                   Cytochrome c-type biogenesis protein CcmF; TIGRFAM:
FT                   cytochrome c-type biogenesis protein CcmF; PFAM: Cytochrome
FT                   C assembly protein; TIGRFAM: c-type cytochrome biogenesis
FT                   protein CcmF; cytochrome c nitrate reductase biogenesis
FT                   protein NrfE"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74517"
FT                   /db_xref="GOA:E1SMG2"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMG2"
FT                   /protein_id="ADN74517.1"
FT                   /translation="MVPELGHYSLIIGLAFAALLAVVPLIGVARKDAYLVSFARPMAYG
FT                   MCLFMALSVVCLGYAFATDDFSVAYVAHNSNSHLPVYFKIAAIWGGHEGSLLFWTFSIS
FT                   IWAATVSAFSKGLEEAFTARVLSVLGMIIVGFALFMLFTSSPFERLLPNVPMEGRDLNP
FT                   MLQDVGLIFHPPLLYLGYVGFSVTFAFAIAALMSGRLDSAWARWSRPWALAAWAFLTAG
FT                   IALGSWWAYYELGWGGWWFWDPVENASFMPWLVGTALIHSLIVTEKRGTFRNWTILLAI
FT                   FTFSLSLLGTFLVRSGVLTSVHSFAADPSRGLFILILLGLTIGGSLMLFALRATELASP
FT                   SRFELLSKETMLLLCNVLLVVATGSVLLGTLYPLLGDALGLGQISVGPPYFNTVFNPIV
FT                   LVMFVFMGIGPFIRWKKAKEGELKRLLPSLIVAIVVAIAAPLLIGGKLNGWIFAGLFTA
FT                   TWITATLVQGLIRECRDTDGSFTMRRITRSYVGMQIAHLGIAMAIVGGTVVSHFESERS
FT                   VRMGPGISESLAGYTFTYEQTRMVQGPNYTAEQGVVTVTQDGDYVTTLYPDRRQYNVRT
FT                   MDMTEAGIDWGFFRDLYVTMGDPLDATHYAVRLNYKPMVRWLWIGSILMMVGGIVAATD
FT                   KRIRAKKPAPAANAKLANA"
     MVPELGHYSL IIGLAFAALL AVVPLIGVAR KDAYLVSFAR PMAYGMCLFM ALSVVCLGYA        60
     FATDDFSVAY VAHNSNSHLP VYFKIAAIWG GHEGSLLFWT FSISIWAATV SAFSKGLEEA       120
     FTARVLSVLG MIIVGFALFM LFTSSPFERL LPNVPMEGRD LNPMLQDVGL IFHPPLLYLG       180
     YVGFSVTFAF AIAALMSGRL DSAWARWSRP WALAAWAFLT AGIALGSWWA YYELGWGGWW       240
     FWDPVENASF MPWLVGTALI HSLIVTEKRG TFRNWTILLA IFTFSLSLLG TFLVRSGVLT       300
     SVHSFAADPS RGLFILILLG LTIGGSLMLF ALRATELASP SRFELLSKET MLLLCNVLLV       360
     VATGSVLLGT LYPLLGDALG LGQISVGPPY FNTVFNPIVL VMFVFMGIGP FIRWKKAKEG       420
     ELKRLLPSLI VAIVVAIAAP LLIGGKLNGW IFAGLFTATW ITATLVQGLI RECRDTDGSF       480
     TMRRITRSYV GMQIAHLGIA MAIVGGTVVS HFESERSVRM GPGISESLAG YTFTYEQTRM       540
     VQGPNYTAEQ GVVTVTQDGD YVTTLYPDRR QYNVRTMDMT EAGIDWGFFR DLYVTMGDPL       600
     DATHYAVRLN YKPMVRWLWI GSILMMVGGI VAATDKRIRA KKPAPAANAK LANA             654
//

If you have problems or comments...

PBIL Back to PBIL home page