(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE307

CP002209.PE307       Location/Qualifiers
FT   CDS             337716..339005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0307"
FT                   /product="competence/damage-inducible protein cinA"
FT                   /note="COGs: COG1058 nucleotide-utilizing enzyme related to
FT                   molybdopterin-biosynthesis enzyme MoeA; InterPro IPR001453:
FT                   IPR008136: IPR008135; KEGG: swd:Swoo_0325
FT                   competence/damage-inducible protein CinA; PFAM: CinA domain
FT                   protein; molybdopterin binding domain; SPTR: B1KNC9
FT                   CinA-like protein; TIGRFAM: competence/damage-inducible
FT                   protein CinA; PFAM: Probable molybdopterin binding domain;
FT                   Competence-damaged protein; TIGRFAM:
FT                   competence/damage-inducible protein CinA N-terminal domain;
FT                   competence/damage-inducible protein CinA C-terminal domain;
FT                   molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74521"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMG6"
FT                   /protein_id="ADN74521.1"
FT                   /translation="MRFEMICTGEEVLSGQIIDTNAAWVAQTLMSQGIEMQRRMTVGDR
FT                   LEDLVEAFRSCAGRADVVLVNGGLGPTADDLSAEAMATLLEVPLELNAEWLETMTRLFE
FT                   RRGRTMSDKNRKQALLPKGATMVDNPVGTACGFRACYQGTWYFFTPGVPSELKRMVHEQ
FT                   LLPWLKASFPIEVPVGLHRMLTIGQGESNLAQLLEPIPLPPGVTLGFRASLPYIEIKLL
FT                   QRRPVDPADWQPLLSAYREALGDALIGENIKTLPEAVHRALLAEGKTLATAESCTGGMV
FT                   ASQLVDLAGSSAYLVAGLVTYSNDAKKALLGVSEATLQQHGAVSLETVLEMAQGARTRM
FT                   GTDMAVSISGIAGPDGGTEAKPVGTVSFALATEQGCVAQTLHLGARDRNAIRLLAATVA
FT                   LDMVRRALLGLPVVAEYGYLNRVEQCQITA"
     MRFEMICTGE EVLSGQIIDT NAAWVAQTLM SQGIEMQRRM TVGDRLEDLV EAFRSCAGRA        60
     DVVLVNGGLG PTADDLSAEA MATLLEVPLE LNAEWLETMT RLFERRGRTM SDKNRKQALL       120
     PKGATMVDNP VGTACGFRAC YQGTWYFFTP GVPSELKRMV HEQLLPWLKA SFPIEVPVGL       180
     HRMLTIGQGE SNLAQLLEPI PLPPGVTLGF RASLPYIEIK LLQRRPVDPA DWQPLLSAYR       240
     EALGDALIGE NIKTLPEAVH RALLAEGKTL ATAESCTGGM VASQLVDLAG SSAYLVAGLV       300
     TYSNDAKKAL LGVSEATLQQ HGAVSLETVL EMAQGARTRM GTDMAVSISG IAGPDGGTEA       360
     KPVGTVSFAL ATEQGCVAQT LHLGARDRNA IRLLAATVAL DMVRRALLGL PVVAEYGYLN       420
     RVEQCQITA                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page