(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE312

CP002209.PE312       Location/Qualifiers
FT   CDS             344322..345230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0312"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="COGs: COG0078 Ornithine carbamoyltransferase;
FT                   InterPro IPR002082: IPR006130: IPR002292: IPR006132: IPR
FT                   006131; KEGG: shl:Shal_4091 ornithine carbamoyltransferase;
FT                   PFAM: aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region; PRIAM: Ornithine
FT                   carbamoyltransferase; SPTR: A2V3G2 Ornithine
FT                   carbamoyltransferase; TIGRFAM: ornithine
FT                   carbamoyltransferase; PFAM: Aspartate/ornithine
FT                   carbamoyltransferase, carbamoyl-P binding domain;
FT                   Aspartate/ornithine carbamoyltransferase, Asp/Orn binding
FT                   domain; TIGRFAM: ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74526"
FT                   /db_xref="GOA:E1SMH1"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH1"
FT                   /protein_id="ADN74526.1"
FT                   /translation="MNHLLSIKDLSPEQIHGLIDLAKTLKADYIPYQDALKGKSVVTLF
FT                   EKPSLRTRVSFDIGINKLGGHCLYLDQQNGAIGQREAVKDFAMNLSRWCDAIVARVFSH
FT                   QTLEELAEYATVPVVNSLSDLYHPCQGLADFLTLSEHYDDLSQVKLGYIGDGNNVTHSL
FT                   MYAAAKLGATMVVVCPPGHFPDGQVVTEAQAIAAEHGGALVLSSDLAALEGVDALYADT
FT                   WISMGDNTPMAAIKAKFQPYQINSKLMSLTGAKYVLHCQPAHREVEITSEVMDSDASLI
FT                   LDQAENRMHIQNAILLELMKD"
     MNHLLSIKDL SPEQIHGLID LAKTLKADYI PYQDALKGKS VVTLFEKPSL RTRVSFDIGI        60
     NKLGGHCLYL DQQNGAIGQR EAVKDFAMNL SRWCDAIVAR VFSHQTLEEL AEYATVPVVN       120
     SLSDLYHPCQ GLADFLTLSE HYDDLSQVKL GYIGDGNNVT HSLMYAAAKL GATMVVVCPP       180
     GHFPDGQVVT EAQAIAAEHG GALVLSSDLA ALEGVDALYA DTWISMGDNT PMAAIKAKFQ       240
     PYQINSKLMS LTGAKYVLHC QPAHREVEIT SEVMDSDASL ILDQAENRMH IQNAILLELM       300
     KD                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page