(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE314

CP002209.PE314       Location/Qualifiers
FT   CDS             346445..348376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0314"
FT                   /product="N-acetylglutamate synthase ;argininosuccinate
FT                   lyase"
FT                   /EC_number="2.3.1.1"
FT                   /EC_number="4.3.2.1"
FT                   /note="COGs: COG0165 Argininosuccinate lyase; InterPro
FT                   IPR000362: IPR000182: IPR020557: IPR009049; KEGG:
FT                   cps:CPS_0464 bifunctional argininosuccinate
FT                   lyase/N-acetylglutamate synthase; PFAM: fumarate lyase;
FT                   GCN5-related N-acetyltransferase; SPTR: P59620 Bifunctional
FT                   protein argH; TIGRFAM: argininosuccinate lyase; PFAM:
FT                   Lyase; Acetyltransferase (GNAT) family; TIGRFAM:
FT                   argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74528"
FT                   /db_xref="GOA:E1SMH3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR011244"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH3"
FT                   /protein_id="ADN74528.1"
FT                   /translation="MTAKGALWGGRFSGAADSRFKLFNDSLPVDYRLVQQDITGSIAWA
FT                   GALQQVGVLDELEHGSLVKALHELSESVTDEQILSSGAEDIHSFVEGALIEKVGDLGKK
FT                   LHTGRSRNDQVATDLKLWCKDQGEQLIEALVRLQQQLLSLAQQEAQTVLPGYTHLQRAQ
FT                   PITFGHWCLAYVEMLERDLTRVKDALARLDRCPLGSGALAGTAYPVDRQALAHALGFAS
FT                   ATANSLDAVSDRDHVVELCSAASTAMMHLSRFAEDLIFYNSGEAGFIELSDAVTSGSSL
FT                   MPQKKNPDALELIRGKAGRVYGALIGILTTMKALPMAYNKDMQEDKEGLFDALDTWLAC
FT                   TEMATLVLDGLKVNSQRTLAAAQQGYANATELADYLVSKGMPFREAHHVVGEVVVAAIA
FT                   AQKALEDFTLPELQAFSGVIQSDVFQHLTIDACLAKRDTLGGTALIQVEQALGNREAKE
FT                   AVAEHDALGGTAPEQVLHALDTSQQRLNAHKAEILKVRNAKLSDVDAIHRINAYWADKG
FT                   DTLPRSRDDVLKDILDFSVAEQEGQVVGCASLYIYETGLAEMRSVGIDPNHHGAGQGRA
FT                   LVDYMLQRGRELELQRVIVLTRVPGFFGKLGFLRTDMAGLPEKVIKDCELCPRKHACDE
FT                   VAMEYRFD"
     MTAKGALWGG RFSGAADSRF KLFNDSLPVD YRLVQQDITG SIAWAGALQQ VGVLDELEHG        60
     SLVKALHELS ESVTDEQILS SGAEDIHSFV EGALIEKVGD LGKKLHTGRS RNDQVATDLK       120
     LWCKDQGEQL IEALVRLQQQ LLSLAQQEAQ TVLPGYTHLQ RAQPITFGHW CLAYVEMLER       180
     DLTRVKDALA RLDRCPLGSG ALAGTAYPVD RQALAHALGF ASATANSLDA VSDRDHVVEL       240
     CSAASTAMMH LSRFAEDLIF YNSGEAGFIE LSDAVTSGSS LMPQKKNPDA LELIRGKAGR       300
     VYGALIGILT TMKALPMAYN KDMQEDKEGL FDALDTWLAC TEMATLVLDG LKVNSQRTLA       360
     AAQQGYANAT ELADYLVSKG MPFREAHHVV GEVVVAAIAA QKALEDFTLP ELQAFSGVIQ       420
     SDVFQHLTID ACLAKRDTLG GTALIQVEQA LGNREAKEAV AEHDALGGTA PEQVLHALDT       480
     SQQRLNAHKA EILKVRNAKL SDVDAIHRIN AYWADKGDTL PRSRDDVLKD ILDFSVAEQE       540
     GQVVGCASLY IYETGLAEMR SVGIDPNHHG AGQGRALVDY MLQRGRELEL QRVIVLTRVP       600
     GFFGKLGFLR TDMAGLPEKV IKDCELCPRK HACDEVAMEY RFD                         643
//

If you have problems or comments...

PBIL Back to PBIL home page