(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE317

CP002209.PE317       Location/Qualifiers
FT   CDS             352211..352816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0317"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="COGs: COG3166 Tfp pilus assembly protein PilN;
FT                   InterPro IPR007813; KEGG: shn:Shewana3_3898 fimbrial
FT                   assembly family protein; PFAM: Fimbrial assembly family
FT                   protein; SPTR: A2V3F7 Fimbrial assembly; PFAM: Fimbrial
FT                   assembly protein (PilN)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74531"
FT                   /db_xref="GOA:E1SMH6"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH6"
FT                   /protein_id="ADN74531.1"
FT                   /translation="MAHINLLPWREAQRARKQKEYLTILGCVGGLTLGLVLAFNMLVGH
FT                   WQEQQRERNQFMQSEIAKLDQQIAEIRRFKEQKANLMRRIEVIETLQQRRHLPVQVMNE
FT                   LARVMVPGVYLTRLQVQDGRVQVEGYCESNNHLANMMREVEQARWLASPKVQQIVASDK
FT                   NENYLGRQHAFKLELTVLSEGEGPLKDEQHLAALGGTR"
     MAHINLLPWR EAQRARKQKE YLTILGCVGG LTLGLVLAFN MLVGHWQEQQ RERNQFMQSE        60
     IAKLDQQIAE IRRFKEQKAN LMRRIEVIET LQQRRHLPVQ VMNELARVMV PGVYLTRLQV       120
     QDGRVQVEGY CESNNHLANM MREVEQARWL ASPKVQQIVA SDKNENYLGR QHAFKLELTV       180
     LSEGEGPLKD EQHLAALGGT R                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page