(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE319

CP002209.PE319       Location/Qualifiers
FT   CDS             353415..353930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0319"
FT                   /product="Pilus assembly protein PilP"
FT                   /note="COGs: COG3168 Tfp pilus assembly protein PilP;
FT                   InterPro IPR007446; KEGG: saz:Sama_3370 type IV pilus
FT                   biogenesis protein PilP; PFAM: Pilus assembly protein PilP;
FT                   SPTR: A2V3F5 Pilus assembly protein, PilQ; PFAM: Pilus
FT                   assembly protein, PilP"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74533"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH8"
FT                   /protein_id="ADN74533.1"
FT                   /translation="MRKVSLAALLLLTGCGGGMGDLREFVADVQSTPVPFNEPPVTPPE
FT                   FKSVPYQVAQLRSPFQQSARSITDPVDLGRPDCPQPDNQRKRATLEAFALDSLDLKGLM
FT                   QDPSHYWALLQAGDGNVYTVKEGDYLGLYHGQIADINDDGVLVTEWIPDGNGCWNQRDT
FT                   RMVLARDE"
     MRKVSLAALL LLTGCGGGMG DLREFVADVQ STPVPFNEPP VTPPEFKSVP YQVAQLRSPF        60
     QQSARSITDP VDLGRPDCPQ PDNQRKRATL EAFALDSLDL KGLMQDPSHY WALLQAGDGN       120
     VYTVKEGDYL GLYHGQIADI NDDGVLVTEW IPDGNGCWNQ RDTRMVLARD E                171
//

If you have problems or comments...

PBIL Back to PBIL home page