(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE32

CP002209.PE32        Location/Qualifiers
FT   CDS             complement(36691..37134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0032"
FT                   /product="globin"
FT                   /note="COGs: COG2346 Truncated hemoglobins; InterPro
FT                   IPR001486; KEGG: tgr:Tgr7_3147 conserved hypothetical
FT                   globin-like protein; PFAM: globin; SPTR: A2V463 Globin;
FT                   PFAM: Bacterial-like globin"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74246"
FT                   /db_xref="GOA:E1SV92"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV92"
FT                   /protein_id="ADN74246.1"
FT                   /translation="MLSLIRRHLSRKQPASAYERMGGEPTVRAIAHRFYQLMADDPDYA
FT                   DLRAIHPDDLSGSELKLFEFLSGWLGGPPLFEEKYGHPMLRARHLPFRVDKRQRNLWLH
FT                   CMKRALEQEVKDRQVRRAMLEALIPLADHMRNTEEGCPVRAPE"
     MLSLIRRHLS RKQPASAYER MGGEPTVRAI AHRFYQLMAD DPDYADLRAI HPDDLSGSEL        60
     KLFEFLSGWL GGPPLFEEKY GHPMLRARHL PFRVDKRQRN LWLHCMKRAL EQEVKDRQVR       120
     RAMLEALIPL ADHMRNTEEG CPVRAPE                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page