(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE320

CP002209.PE320       Location/Qualifiers
FT   CDS             353943..355988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0320"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="COGs: COG4796 Type II secretory pathway component
FT                   HofQ; InterPro IPR001775: IPR004846: IPR011662: IPR005644:
FT                   IPR 018252: IPR004845: IPR013355; KEGG: shw:Sputw3181_3848
FT                   type IV pilus secretin PilQ; PFAM: type II and III
FT                   secretion system protein; Secretin/TonB short domain; NolW
FT                   domain protein; SPTR: A2V3F4 Type IV pilus secretin PilQ;
FT                   TIGRFAM: type IV pilus secretin PilQ; PFAM: Bacterial type
FT                   II/III secretion system short domain; Secretin and TonB N
FT                   terminus short domain; Bacterial type II and III secretion
FT                   system protein; TIGRFAM: type IV pilus secretin (or
FT                   competence protein) PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74534"
FT                   /db_xref="GOA:E1SMH9"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH9"
FT                   /protein_id="ADN74534.1"
FT                   /translation="MSFFSGIRQGLPRLQHRIIASRLLLGGVLLCLANSATAGTLQDLR
FT                   YQAQVDDMLEVELAFDQLAGEPRIAVSANPAELTLHFAGSQSGLQMSQIPIDLKGIKAV
FT                   ETRSGSNGLDVVFQLEKMTTYQGRLDGNRYRITFNDNSPVARAETPQFLNEIESINFHR
FT                   GDNGQAQLVLSLSSPTAAANFNRVGSDLELTLYNTRIQDKDLYIVDVQDFSTVVTGFET
FT                   FRDNANARLRFDVRGEFVFDSRQEGNRLVIDIAEQTQPLMEEKVYDGSTLSMNFQDVPV
FT                   RTVLQIIADHNQFNLVTTENVAGNLTLHLDKVPWDQALDMILKIRGLDKRIEGNILLVA
FT                   PRDELAAQESLELRAAQEVREVAPLFSEYLQINYAKAVDIATLLDNDGNTLLSERGSVS
FT                   VDERTNTLLVYDTAERLEDIHRLVDILDVPVKQVVIESRMVTVRDNINEELGIRWGISD
FT                   QQGDKGTAGTLPGAEDIANGIVPSLSDRLNVNLPVVEPAGSIAFHVAKLGDGTLLDLEL
FT                   SALERENKGEIIASPRLTTANQYTAFIEQGTEIPFVQSTSSGATSVEFKKAVLGLTVTP
FT                   QITPDNRIVLDLTVTQDTRGETVQTATGPAVAIDTQRISTQVLAQNGETIVLGGIFQQQ
FT                   QLNTVTKVPLLGDIPFVGVLFRNSQDFTEKKELLIFVTPKIVIDEF"
     MSFFSGIRQG LPRLQHRIIA SRLLLGGVLL CLANSATAGT LQDLRYQAQV DDMLEVELAF        60
     DQLAGEPRIA VSANPAELTL HFAGSQSGLQ MSQIPIDLKG IKAVETRSGS NGLDVVFQLE       120
     KMTTYQGRLD GNRYRITFND NSPVARAETP QFLNEIESIN FHRGDNGQAQ LVLSLSSPTA       180
     AANFNRVGSD LELTLYNTRI QDKDLYIVDV QDFSTVVTGF ETFRDNANAR LRFDVRGEFV       240
     FDSRQEGNRL VIDIAEQTQP LMEEKVYDGS TLSMNFQDVP VRTVLQIIAD HNQFNLVTTE       300
     NVAGNLTLHL DKVPWDQALD MILKIRGLDK RIEGNILLVA PRDELAAQES LELRAAQEVR       360
     EVAPLFSEYL QINYAKAVDI ATLLDNDGNT LLSERGSVSV DERTNTLLVY DTAERLEDIH       420
     RLVDILDVPV KQVVIESRMV TVRDNINEEL GIRWGISDQQ GDKGTAGTLP GAEDIANGIV       480
     PSLSDRLNVN LPVVEPAGSI AFHVAKLGDG TLLDLELSAL ERENKGEIIA SPRLTTANQY       540
     TAFIEQGTEI PFVQSTSSGA TSVEFKKAVL GLTVTPQITP DNRIVLDLTV TQDTRGETVQ       600
     TATGPAVAID TQRISTQVLA QNGETIVLGG IFQQQQLNTV TKVPLLGDIP FVGVLFRNSQ       660
     DFTEKKELLI FVTPKIVIDE F                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page