(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE33

CP002209.PE33        Location/Qualifiers
FT   CDS             37164..37988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0033"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="COGs: COG0169 Shikimate 5-dehydrogenase; InterPro
FT                   IPR013708: IPR006151: IPR011342; KEGG: avn:Avin_00230
FT                   shikimate/quinate 5-dehydrogenase; PFAM: Shikimate
FT                   dehydrogenase substrate binding domain protein;
FT                   Shikimate/quinate 5-dehydrogenase; SPTR: A4VFI4 Shikimate
FT                   dehydrogenase; TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate dehydrogenase substrate binding domain; Shikimate
FT                   / quinate 5-dehydrogenase; TIGRFAM: shikimate
FT                   5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74247"
FT                   /db_xref="GOA:E1SV93"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV93"
FT                   /protein_id="ADN74247.1"
FT                   /translation="MDQYAVFGHPIAHSQSPFIHQAFAGQTAQELEYRAILAPTDGFAE
FT                   AVRQFRQQGGLGANVTLPFKEQAAALCDQLTERARLAGAVNTLHWLADGSLLGDNTDGA
FT                   GMVADLHQHGVTLTNRRILILGAGGAVRGVLEPVLACQPRQLVIANRTASKAEALARDF
FT                   AGLGEVVGCGFDQIEGAFDLIINGTSASLSGDLPPLPPHCLIAGGITYDMAYGVNATPF
FT                   QCWGERHGGRLNLAGLGMLVNQAAESFYRWRGVRPDTGPVHQALLARLEEKQ"
     MDQYAVFGHP IAHSQSPFIH QAFAGQTAQE LEYRAILAPT DGFAEAVRQF RQQGGLGANV        60
     TLPFKEQAAA LCDQLTERAR LAGAVNTLHW LADGSLLGDN TDGAGMVADL HQHGVTLTNR       120
     RILILGAGGA VRGVLEPVLA CQPRQLVIAN RTASKAEALA RDFAGLGEVV GCGFDQIEGA       180
     FDLIINGTSA SLSGDLPPLP PHCLIAGGIT YDMAYGVNAT PFQCWGERHG GRLNLAGLGM       240
     LVNQAAESFY RWRGVRPDTG PVHQALLARL EEKQ                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page