(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE332

CP002209.PE332       Location/Qualifiers
FT   CDS             complement(364499..365086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0332"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /note="COGs: COG0279 Phosphoheptose isomerase; KEGG:
FT                   sbp:Sbal223_3991 phosphoheptose isomerase; SPTR: A9L683
FT                   Phosphoheptose isomerase; PFAM: SIS domain; TIGRFAM:
FT                   phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74546"
FT                   /db_xref="GOA:E1SMJ1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMJ1"
FT                   /protein_id="ADN74546.1"
FT                   /translation="MLERIKESFTESIQTKIDALEALPESIEKGAMAMVHCLLSGNKIL
FT                   CCGNGGSAGDAQHFSSELLNRFETERPSLPAIALTTDSSTLTSIANDYSFSEVFSKQVH
FT                   ALGQRGDILLAISTSGNSQNVIKAMEAAVNRDMTIVALTGNDGGAMAGLLSDNDVEIRV
FT                   PSHSTPRIQEVHLLVLHSLCDVIDRTLFPQED"
     MLERIKESFT ESIQTKIDAL EALPESIEKG AMAMVHCLLS GNKILCCGNG GSAGDAQHFS        60
     SELLNRFETE RPSLPAIALT TDSSTLTSIA NDYSFSEVFS KQVHALGQRG DILLAISTSG       120
     NSQNVIKAME AAVNRDMTIV ALTGNDGGAM AGLLSDNDVE IRVPSHSTPR IQEVHLLVLH       180
     SLCDVIDRTL FPQED                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page