(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE336

CP002209.PE336       Location/Qualifiers
FT   CDS             complement(368787..369806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0336"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_0104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74550"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMJ5"
FT                   /protein_id="ADN74550.1"
FT                   /translation="MRYSKLARALTLLGSALPLAAMAADPVMIDFSEGGVEGNLGTSTV
FT                   MDAATGTSALGLYLDPNDNLWKPANLYRRDQTGDEGLGVCNPLEAADNGGDCPGPGGGG
FT                   DINELSNQLAPEFIYLKRPEHWRWVSVYLSSLDGNDGAEFPETGQIWSDTDGNPNNGGL
FT                   VLLAEFTGNDDNVEQVLDIAALGAADAPFLVLRPVDIAPDGTDTNNDFLVKAAVIEEKP
FT                   KEPPMGGQGCTPGYWKQPHHFDSWVMYGPHDTFYMAFGSDLFGMDKTLLQVLSQGGGKE
FT                   YAMGRHAVAALLNALSDGVSYKYSKEEVIAAVQGAHSGSYNHVKNAFEYQNEMGCPLN"
     MRYSKLARAL TLLGSALPLA AMAADPVMID FSEGGVEGNL GTSTVMDAAT GTSALGLYLD        60
     PNDNLWKPAN LYRRDQTGDE GLGVCNPLEA ADNGGDCPGP GGGGDINELS NQLAPEFIYL       120
     KRPEHWRWVS VYLSSLDGND GAEFPETGQI WSDTDGNPNN GGLVLLAEFT GNDDNVEQVL       180
     DIAALGAADA PFLVLRPVDI APDGTDTNND FLVKAAVIEE KPKEPPMGGQ GCTPGYWKQP       240
     HHFDSWVMYG PHDTFYMAFG SDLFGMDKTL LQVLSQGGGK EYAMGRHAVA ALLNALSDGV       300
     SYKYSKEEVI AAVQGAHSGS YNHVKNAFEY QNEMGCPLN                              339
//

If you have problems or comments...

PBIL Back to PBIL home page