(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE342

CP002209.PE342       Location/Qualifiers
FT   CDS             375147..376514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0342"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diamin
FT                   opimelate/D-alanyl-D-alanylligase"
FT                   /note="COGs: COG0770 UDP-N-acetylmuramyl pentapeptide
FT                   synthase; InterPro IPR000713: IPR004101: IPR013221:
FT                   IPR005863; KEGG: eic:NT01EI_0732
FT                   UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase;
FT                   PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; SPTR: P11880
FT                   UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase;
FT                   TIGRFAM:UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-d
FT                   iaminopimelate/D-alanyl-D-alanylligase; PFAM: Mur ligase
FT                   family, glutamate ligase domain; Mur ligase family,
FT                   catalytic domain; Mur ligase middle domain; TIGRFAM:
FT                   UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74556"
FT                   /db_xref="GOA:E1SMK1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMK1"
FT                   /protein_id="ADN74556.1"
FT                   /translation="MIPVTLSTLADAVGGTLNGADLMVSRIGTDTRALAEGDLFLALVG
FT                   DRFDGHEFVAQAEASGAAALVVSRPVDSALPQILVEDTLLALGQMGAWLRRELAPRCLA
FT                   ITGSVGKTSVKEMTAAIFAQVGPTLATRGNLNNTIGVPMTLLELTPEHRFAVIELGANH
FT                   AGEIRYTSSLALPHAAVINNIRGAHLEGFGGIEGVARAKSEIYEHLGEAGTAIVNLDDE
FT                   WAPWLLERLGDQNRFTYSSRGPADLWASALSRDADGCYHFLLHRGEAEVLVRLPLPGRH
FT                   QVDNALAAAALASTAELSLEQIASGLAQAPTVAGRTQMTALSGEVMLIDDSYNANAAST
FT                   MAAIDLMAERDGSSLLVFGDMGELGEEAEAEHRTVGRYAGEKGIDRLLTVGTLSRFAAQ
FT                   EHDAARHFGDQAELLPTLMTELAALPRPVTVLIKGSRSARMENVAKALREQLGEHE"
     MIPVTLSTLA DAVGGTLNGA DLMVSRIGTD TRALAEGDLF LALVGDRFDG HEFVAQAEAS        60
     GAAALVVSRP VDSALPQILV EDTLLALGQM GAWLRRELAP RCLAITGSVG KTSVKEMTAA       120
     IFAQVGPTLA TRGNLNNTIG VPMTLLELTP EHRFAVIELG ANHAGEIRYT SSLALPHAAV       180
     INNIRGAHLE GFGGIEGVAR AKSEIYEHLG EAGTAIVNLD DEWAPWLLER LGDQNRFTYS       240
     SRGPADLWAS ALSRDADGCY HFLLHRGEAE VLVRLPLPGR HQVDNALAAA ALASTAELSL       300
     EQIASGLAQA PTVAGRTQMT ALSGEVMLID DSYNANAAST MAAIDLMAER DGSSLLVFGD       360
     MGELGEEAEA EHRTVGRYAG EKGIDRLLTV GTLSRFAAQE HDAARHFGDQ AELLPTLMTE       420
     LAALPRPVTV LIKGSRSARM ENVAKALREQ LGEHE                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page