(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE344

CP002209.PE344       Location/Qualifiers
FT   CDS             377594..378895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0344"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="COGs: COG0771
FT                   UDP-N-acetylmuramoylalanine-D-glutamate ligase; InterPro
FT                   IPR004101: IPR013221: IPR006162: IPR005762; KEGG:
FT                   spl:Spea_3813 UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase; PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; SPTR: A2UXQ8
FT                   UDP-N-acetylmuramoylalanine--D-glutamate ligase; TIGRFAM:
FT                   UDP-N-acetylmuramoylalanine/D-glutamate ligase; PFAM: Mur
FT                   ligase family, glutamate ligase domain; Mur ligase middle
FT                   domain; TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74558"
FT                   /db_xref="GOA:E1SMK3"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMK3"
FT                   /protein_id="ADN74558.1"
FT                   /translation="MTTPAPHTWILGLGITGLSVVRHLAAESESLAVWDSRANPPGADT
FT                   LARDFAHVALQTGPFDGDVLAQAKRLVVSPGIDLRTPALAQAIAAGVEVVGDIELFARA
FT                   ADAPVVAITGSNGKSTVTTLVGHLAQACGVSVGVGGNIGTPALDLLGQGHQLYVLELSS
FT                   FQLETTRSLPAQVGTVLNVSPDHLDRYDSYEAYRDAKLALYPQCRIALFNRADHNTLPS
FT                   SHPRTLSFGPDAPDGDNFGVVGDWLMQGQTRLKRRDQLTLVGAHNEQNVLAALALGQAA
FT                   GLEMDAMLSALDSYRGLPHRCELVAERAGVRYVNDSKATNLGATQAALDGLELGRVWLI
FT                   AGGDAKGQDLSVLAPALNQLAGLITLGQDGPAIAALRSDATEVVSIESAVAVAADQARA
FT                   GDIVLLSPACSSLDMFASFEQRGECFAAAARGLR"
     MTTPAPHTWI LGLGITGLSV VRHLAAESES LAVWDSRANP PGADTLARDF AHVALQTGPF        60
     DGDVLAQAKR LVVSPGIDLR TPALAQAIAA GVEVVGDIEL FARAADAPVV AITGSNGKST       120
     VTTLVGHLAQ ACGVSVGVGG NIGTPALDLL GQGHQLYVLE LSSFQLETTR SLPAQVGTVL       180
     NVSPDHLDRY DSYEAYRDAK LALYPQCRIA LFNRADHNTL PSSHPRTLSF GPDAPDGDNF       240
     GVVGDWLMQG QTRLKRRDQL TLVGAHNEQN VLAALALGQA AGLEMDAMLS ALDSYRGLPH       300
     RCELVAERAG VRYVNDSKAT NLGATQAALD GLELGRVWLI AGGDAKGQDL SVLAPALNQL       360
     AGLITLGQDG PAIAALRSDA TEVVSIESAV AVAADQARAG DIVLLSPACS SLDMFASFEQ       420
     RGECFAAAAR GLR                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page