(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE346

CP002209.PE346       Location/Qualifiers
FT   CDS             380105..381190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0346"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="COGs: COG0707 UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase; InterPro IPR004276:
FT                   IPR007235: IPR006009; KEGG: slo:Shew_3453
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase; PFAM: glycosyl
FT                   transferase family 28; Glycosyltransferase 28 domain;
FT                   PRIAM: Undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase; SPTR: A3QIM1
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase;
FT                   TIGRFAM:UDP-N-acetylglucosamine--N-acetylmuramyl-
FT                   (pentapeptide) pyrophosphoryl-undecaprenol
FT                   N-acetylglucosamine transferase; PFAM: Glycosyltransferase
FT                   family 28 N-terminal domain; Glycosyltransferase family 28
FT                   C-terminal domain; TIGRFAM:
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74560"
FT                   /db_xref="GOA:E1SMK5"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMK5"
FT                   /protein_id="ADN74560.1"
FT                   /translation="MSDNKAPRLMVMAGGTGGHVFPALAVARRLRQQGWEVLWLGTAER
FT                   MEARLVPQHGFAIRFIDIKGVRGNGLLRKLKAPFQIFKAIAQARRIQAEFQPDVVMGMG
FT                   GYAAGPGGIAAWLRRTPLVLHEQNAVAGATNAILAKFANKVLVAFDNVLPGEQRVGNPV
FT                   RDELVAIGETQPVVPGEQLKVLVVGGSLGAQVLNDQVPAAVGRLANEAAVTVWHQVGRG
FT                   NEAAVTQRWAEMAPGVGAQVTEFIDDMAAAYAWADLVICRAGALTVAELAATGRPSLLV
FT                   PFPHAVDDHQTKNAEALVAAGAARLLPQASLTPERLADEMLTLVQQPDTLVQMAEAARN
FT                   SAILDATDKVAGICASLARRD"
     MSDNKAPRLM VMAGGTGGHV FPALAVARRL RQQGWEVLWL GTAERMEARL VPQHGFAIRF        60
     IDIKGVRGNG LLRKLKAPFQ IFKAIAQARR IQAEFQPDVV MGMGGYAAGP GGIAAWLRRT       120
     PLVLHEQNAV AGATNAILAK FANKVLVAFD NVLPGEQRVG NPVRDELVAI GETQPVVPGE       180
     QLKVLVVGGS LGAQVLNDQV PAAVGRLANE AAVTVWHQVG RGNEAAVTQR WAEMAPGVGA       240
     QVTEFIDDMA AAYAWADLVI CRAGALTVAE LAATGRPSLL VPFPHAVDDH QTKNAEALVA       300
     AGAARLLPQA SLTPERLADE MLTLVQQPDT LVQMAEAARN SAILDATDKV AGICASLARR       360
     D                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page