(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE350

CP002209.PE350       Location/Qualifiers
FT   CDS             384319..385554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0350"
FT                   /product="cell division protein FtsA"
FT                   /note="COGs: COG0849 Actin-like ATPase involved in cell
FT                   division; InterPro IPR003494; KEGG: slo:Shew_3450 cell
FT                   division protein FtsA; PFAM: cell division protein FtsA;
FT                   SPTR: A3WNF8 Cell division ATPase, FtsA; TIGRFAM: cell
FT                   division protein FtsA; PFAM: Cell division protein FtsA;
FT                   TIGRFAM: cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74564"
FT                   /db_xref="GOA:E1SN65"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN65"
FT                   /protein_id="ADN74564.1"
FT                   /translation="MTTSTETGLVVGLDIGTAQVTAVIGEVLPDGEISVIGIGSQLSRG
FT                   MDKGGVNDLDSVVRCVRLALTQAENMAQCEVASVYLSISGHHISCQNEKGMVSIDGAEV
FT                   MQEDVDHVIHTAQSVKIPNERRILHVLPQEFTIDELEGIRSPVGMSGMRMEAKVHMVTC
FT                   ASDWARNITKCVERCGIHVDGLVFSGIASAESVLTEDEKDLGVCLVDIGAGTTDIAIYS
FT                   GGALRHCQVIPVAGNQVTSDIAKIFRTPLSHAEQIKVQFACARSGLVSSEDSIEVPSVG
FT                   GRPARTMSRQTLAEVVEPRYQELFELVADALRASGLEDQVAAGVVLTGGTAQIEGAEVV
FT                   AEECFGMPVRLAQPLPLKGLNDYIREPSYATAVGLLHHGAQQLMEKTQERAPQNGISQL
FT                   LTRMQSWFKGEF"
     MTTSTETGLV VGLDIGTAQV TAVIGEVLPD GEISVIGIGS QLSRGMDKGG VNDLDSVVRC        60
     VRLALTQAEN MAQCEVASVY LSISGHHISC QNEKGMVSID GAEVMQEDVD HVIHTAQSVK       120
     IPNERRILHV LPQEFTIDEL EGIRSPVGMS GMRMEAKVHM VTCASDWARN ITKCVERCGI       180
     HVDGLVFSGI ASAESVLTED EKDLGVCLVD IGAGTTDIAI YSGGALRHCQ VIPVAGNQVT       240
     SDIAKIFRTP LSHAEQIKVQ FACARSGLVS SEDSIEVPSV GGRPARTMSR QTLAEVVEPR       300
     YQELFELVAD ALRASGLEDQ VAAGVVLTGG TAQIEGAEVV AEECFGMPVR LAQPLPLKGL       360
     NDYIREPSYA TAVGLLHHGA QQLMEKTQER APQNGISQLL TRMQSWFKGE F                411
//

If you have problems or comments...

PBIL Back to PBIL home page