(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE351

CP002209.PE351       Location/Qualifiers
FT   CDS             385588..386808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0351"
FT                   /product="cell division protein FtsZ"
FT                   /note="COGs: COG0206 Cell division GTPase; InterPro
FT                   IPR000158: IPR018316: IPR003008; KEGG: shl:Shal_0459 cell
FT                   division protein FtsZ; PFAM: Tubulin/FtsZ GTPase;
FT                   Tubulin/FtsZ, 2-layer sandwich domain; SPTR: P0A9A6 Cell
FT                   division protein ftsZ; TIGRFAM: cell division protein FtsZ;
FT                   PFAM: Tubulin/FtsZ family, GTPase domain; FtsZ family,
FT                   C-terminal domain; TIGRFAM: cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74565"
FT                   /db_xref="GOA:E1SN66"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN66"
FT                   /protein_id="ADN74565.1"
FT                   /translation="MFEIVDCHNDDAVIKVIGVGGGGGNAVEHMVEQTIEGVEFICANT
FT                   DSQALRKSSANTTIQLGKNVTKGLGAGANPEVGREAALEDRETIRAAIAGSDMVFIAAG
FT                   MGGGTGTGAAPVVAEVAKEEGILTVAVVTKPFSFEGKKRSAFADQGIDLLSKHVDSLIT
FT                   VPNDKLLKVLGGRTSLLDAFKAANNVLLGAVQGIAELITRPGLINVDFADVKTVMSEMG
FT                   NAMMGTGVARGEDRAEEAAEAAVASPLLEDIDLSGARGVLVNITAGLDISIEEFETVGN
FT                   HVKAYASENATVVVGAVIDPEMSDELRVTVVATGIGAEKKPDIQLVSNAVAKPKQPEPA
FT                   RDAYTAEPAAPSMTRPAVEPSHNEPAEPMRTSVGGQGGAAAAKQPNENLNKDNYLDIPA
FT                   FLRRQAD"
     MFEIVDCHND DAVIKVIGVG GGGGNAVEHM VEQTIEGVEF ICANTDSQAL RKSSANTTIQ        60
     LGKNVTKGLG AGANPEVGRE AALEDRETIR AAIAGSDMVF IAAGMGGGTG TGAAPVVAEV       120
     AKEEGILTVA VVTKPFSFEG KKRSAFADQG IDLLSKHVDS LITVPNDKLL KVLGGRTSLL       180
     DAFKAANNVL LGAVQGIAEL ITRPGLINVD FADVKTVMSE MGNAMMGTGV ARGEDRAEEA       240
     AEAAVASPLL EDIDLSGARG VLVNITAGLD ISIEEFETVG NHVKAYASEN ATVVVGAVID       300
     PEMSDELRVT VVATGIGAEK KPDIQLVSNA VAKPKQPEPA RDAYTAEPAA PSMTRPAVEP       360
     SHNEPAEPMR TSVGGQGGAA AAKQPNENLN KDNYLDIPAF LRRQAD                      406
//

If you have problems or comments...

PBIL Back to PBIL home page