(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE354

CP002209.PE354       Location/Qualifiers
FT   CDS             388297..389202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0354"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR016047; KEGG:
FT                   slo:Shew_3446 peptidase M23B; PFAM: Peptidase M23; SPTR:
FT                   A2V4N1 Peptidase M23B; PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74568"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN69"
FT                   /protein_id="ADN74568.1"
FT                   /translation="MSVTVFIRGKHGVRRIEPGKRWLLAPLMLVAAGATLWWQARENVS
FT                   TVEHQLAAASASTEHHQNEIAALRDRTEAQLSLLAARLGRMQARMNRIESLGIAVADRV
FT                   ELSDQFDFQSEVGLGSSGVEPSEQVELSLLLEEMDQMMLRLERADDQLALLETLERHHH
FT                   IDEDTYLSGRPLSKGWQSSSFGYRNDPFNGRRTLHRGLDFAGPEGGEVIATGAGVVSYS
FT                   GTMFGYGNLVEIDHGNGVKTRYGHNKENLVELGQVVAKGETVALIGNTGRSTGPHVHYE
FT                   VMLNDQQVDPARYVYRKPRT"
     MSVTVFIRGK HGVRRIEPGK RWLLAPLMLV AAGATLWWQA RENVSTVEHQ LAAASASTEH        60
     HQNEIAALRD RTEAQLSLLA ARLGRMQARM NRIESLGIAV ADRVELSDQF DFQSEVGLGS       120
     SGVEPSEQVE LSLLLEEMDQ MMLRLERADD QLALLETLER HHHIDEDTYL SGRPLSKGWQ       180
     SSSFGYRNDP FNGRRTLHRG LDFAGPEGGE VIATGAGVVS YSGTMFGYGN LVEIDHGNGV       240
     KTRYGHNKEN LVELGQVVAK GETVALIGNT GRSTGPHVHY EVMLNDQQVD PARYVYRKPR       300
     T                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page