(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE360

CP002209.PE360       Location/Qualifiers
FT   CDS             complement(395025..395648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0360"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="COGs: COG0237 Dephospho-CoA kinase; InterPro
FT                   IPR001977; KEGG: son:SO_0413 dephospho-CoA kinase; PRIAM:
FT                   Dephospho-CoA kinase; SPTR: Q8EJP9 Dephospho-CoA kinase;
FT                   TIGRFAM: dephospho-CoA kinase; PFAM: Dephospho-CoA kinase;
FT                   TIGRFAM: dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74574"
FT                   /db_xref="GOA:E1SN75"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN75"
FT                   /protein_id="ADN74574.1"
FT                   /translation="MSDLIVGLTGGIGSGKSQVSDQFAQLGVTVVDADIIARDVVTPGS
FT                   YGLQAIVDHFGETLLNPDGTLNRAELRRRVFNDEAERQWLNNLTHPMIRTEMQRQCREA
FT                   PGEYALMVVPLMVENGLQALVDRLIVVDVPESQQRHRTALRDQTDGNEVDKIIARQASR
FT                   SERLALADEVIDNSGPIEALTPQVHRLHQKFLTLARSRSSATGV"
     MSDLIVGLTG GIGSGKSQVS DQFAQLGVTV VDADIIARDV VTPGSYGLQA IVDHFGETLL        60
     NPDGTLNRAE LRRRVFNDEA ERQWLNNLTH PMIRTEMQRQ CREAPGEYAL MVVPLMVENG       120
     LQALVDRLIV VDVPESQQRH RTALRDQTDG NEVDKIIARQ ASRSERLALA DEVIDNSGPI       180
     EALTPQVHRL HQKFLTLARS RSSATGV                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page